Fucosyltransferase 7/FUT7 Antibody (1C12)

Images

 
ELISA: Fucosyltransferase 7/FUT7 Antibody (1C12) [H00002529-M03] - Detection limit for recombinant GST tagged FUT7 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1C12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Fucosyltransferase 7/FUT7 Antibody (1C12) Summary

Immunogen
FUT7 (NP_004470 262 a.a. - 342 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA
Specificity
FUT7 - fucosyltransferase 7 (alpha (1,3) fucosyltransferase), (1C12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FUT7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Fucosyltransferase 7/FUT7 Antibody (1C12)

  • alpha-(1,3)-fucosyltransferase
  • EC 2.4.1
  • EC 2.4.1.-
  • EC 2.4.1.65
  • fucosyltransferase 7 (alpha (1,3) fucosyltransferase)
  • Fucosyltransferase 7
  • Fucosyltransferase VII
  • Fuc-TVII
  • FucT-VII
  • FUT7
  • Galactoside 3-L-fucosyltransferase
  • Selectin ligand synthase
  • selectin-ligand synthase

Background

The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X antigens. The encoded protein can direct the synthesis of the E-selectin-binding sialyl-Lewis X moiety.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-78039
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-CS
NBP1-42795
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, CyTOF-ready
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-55006
Species: Hu
Applications: ICC/IF
NBP2-14921
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
4949-GT
Species: Hu
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-57960
Species: Hu
Applications: ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF7248
Species: Hu
Applications: WB, ICC
NBP1-69565
Species: Hu
Applications: WB, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for Fucosyltransferase 7/FUT7 Antibody (H00002529-M03) (0)

There are no publications for Fucosyltransferase 7/FUT7 Antibody (H00002529-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fucosyltransferase 7/FUT7 Antibody (H00002529-M03) (0)

There are no reviews for Fucosyltransferase 7/FUT7 Antibody (H00002529-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fucosyltransferase 7/FUT7 Antibody (H00002529-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fucosyltransferase 7/FUT7 Products

Bioinformatics Tool for Fucosyltransferase 7/FUT7 Antibody (H00002529-M03)

Discover related pathways, diseases and genes to Fucosyltransferase 7/FUT7 Antibody (H00002529-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fucosyltransferase 7/FUT7 Antibody (H00002529-M03)

Discover more about diseases related to Fucosyltransferase 7/FUT7 Antibody (H00002529-M03).
 

Pathways for Fucosyltransferase 7/FUT7 Antibody (H00002529-M03)

View related products by pathway.

PTMs for Fucosyltransferase 7/FUT7 Antibody (H00002529-M03)

Learn more about PTMs related to Fucosyltransferase 7/FUT7 Antibody (H00002529-M03).

Blogs on Fucosyltransferase 7/FUT7

There are no specific blogs for Fucosyltransferase 7/FUT7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fucosyltransferase 7/FUT7 Antibody (1C12) and receive a gift card or discount.

Bioinformatics

Gene Symbol FUT7
Entrez
Uniprot