FTO Recombinant Protein Antigen

Images

 
There are currently no images for FTO Recombinant Protein Antigen (NBP2-62659PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FTO Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FTO.

Source: E. coli

Amino Acid Sequence: LFRDLVRIQGKDLLTPVSRILIGNPGCTYKYLNTRLFTVPWPVKGSNIKHTEAEIAAACETFLKLNDYLQIETIQALEELAA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FTO
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62659.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FTO Recombinant Protein Antigen

  • Alpha-ketoglutarate-dependent dioxygenase FTO
  • EC 1.14.11.-
  • fat mass and obesity associated
  • Fat mass and obesity-associated protein
  • FTO
  • KIAA1752protein fto
  • MGC5149

Background

Fat mass and obesity-associated protein (FTO) is a novel protein and a member of the non-heme dioxygenase (Fe(II)- and 2-oxoglutarate-dependent dioxygenases) superfamily. Though not much is yet known about FTO, it is thought that the protein may somehow modify the activity of genes involved in metabolism and fat storage, which in turn may influence a person's risk of obesity.

FTO antibodies are useful tools for lipid metabolism research and obesity studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41103
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-19083
Species: Hu
Applications: ICC/IF, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-32796
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
MAB7936
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow
NBP2-02627
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00003087-M02
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-81843
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
DLP00
Species: Hu
Applications: ELISA
DBD00
Species: Hu
Applications: ELISA
NBP1-76997
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF497
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP3-03000
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-76944
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF5394
Species: Hu, Mu
Applications: WB
NBP1-76998
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF6915
Species: Hu, Mu, Rt
Applications: WB

Publications for FTO Recombinant Protein Antigen (NBP2-62659PEP) (0)

There are no publications for FTO Recombinant Protein Antigen (NBP2-62659PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FTO Recombinant Protein Antigen (NBP2-62659PEP) (0)

There are no reviews for FTO Recombinant Protein Antigen (NBP2-62659PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FTO Recombinant Protein Antigen (NBP2-62659PEP). (Showing 1 - 1 of 1 FAQ).

  1. Do you have any antibodies against FTO, where you can indicate the sequence of the immunogen?
    • With regards to other FTO antibodies that we do list the peptide sequence for, the immunogen sequence for catalog number NB110-60935 can be found in the range of amino acids 400-505. Many of the exact immunogen sequences used for our products are proprietary and cannot be disclosed. In these instances we try to provide a reasonable amino acid range to help in your decision.

Additional FTO Products

Array NBP2-62659PEP

Research Areas for FTO Recombinant Protein Antigen (NBP2-62659PEP)

Find related products by research area.

Blogs on FTO

There are no specific blogs for FTO, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FTO Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FTO