FTO Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

FTO Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FTO.
  
  

  Source: E. coli

  Amino Acid Sequence: LFRDLVRIQGKDLLTPVSRILIGNPGCTYKYLNTRLFTVPWPVKGSNIKHTEAEIAAACETFLKLNDYLQIETIQALEELAA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: FTO
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62659.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FTO Recombinant Protein Antigen

• Alpha-ketoglutarate-dependent dioxygenase FTO
• EC 1.14.11.-
• fat mass and obesity associated
• Fat mass and obesity-associated protein
• FTO
• KIAA1752protein fto
• MGC5149

Background

Fat mass and obesity-associated protein (FTO) is a novel protein and a member of the non-heme dioxygenase (Fe(II)- and 2-oxoglutarate-dependent dioxygenases) superfamily. Though not much is yet known about FTO, it is thought that the protein may somehow modify the activity of genes involved in metabolism and fat storage, which in turn may influence a person's risk of obesity.

FTO antibodies are useful tools for lipid metabolism research and obesity studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for FTO Recombinant Protein Antigen (NBP2-62659PEP). (Showing 1 - 1 of 1 FAQ).

1. Do you have any antibodies against FTO, where you can indicate the sequence of the immunogen?
   • With regards to other FTO antibodies that we do list the peptide sequence for, the immunogen sequence for catalog number NB110-60935 can be found in the range of amino acids 400-505. Many of the exact immunogen sequences used for our products are proprietary and cannot be disclosed. In these instances we try to provide a reasonable amino acid range to help in your decision.

Bioinformatics

• Gene Symbol: FTO