FTO Antibody


Western Blot: FTO Antibody [NBP1-69021] - Mouse Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

FTO Antibody Summary

Synthetic peptides corresponding to Fto (fat mass and obesity associated) The peptide sequence was selected from the N terminal of Fto. Peptide sequence MKRVQTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Fto and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FTO Antibody

  • Alpha-ketoglutarate-dependent dioxygenase FTO
  • EC 1.14.11.-
  • fat mass and obesity associated
  • Fat mass and obesity-associated protein
  • FTO
  • KIAA1752protein fto
  • MGC5149


Fto is a dioxygenase that repairs alkylated DNA and RNA by oxidative demethylation. Fto has highest activity towards single-stranded RNA containing 3-methyluracil, followed by single-stranded DNA containing 3-methylthymine. Fto has low demethylase activity towards single-stranded DNA containing 1-methyladenine or 3-methylcytosine. Fto has no activity towards 1-methylguanine and no detectable activity towards double-stranded DNA. Fto requires molecular oxygen, alpha-ketoglutarate and iron. Fto contributes to the regulation of the global metabolic rate, energy expenditure and energy homeostasis. Fto contributes to the regulation of body size and body fat accumulation.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Mu
Applications: WB

Publications for FTO Antibody (NBP1-69021) (0)

There are no publications for FTO Antibody (NBP1-69021).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FTO Antibody (NBP1-69021) (0)

There are no reviews for FTO Antibody (NBP1-69021). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FTO Antibody (NBP1-69021). (Showing 1 - 1 of 1 FAQ).

  1. Do you have any antibodies against FTO, where you can indicate the sequence of the immunogen?
    • With regards to other FTO antibodies that we do list the peptide sequence for, the immunogen sequence for catalog number NB110-60935 can be found in the range of amino acids 400-505. Many of the exact immunogen sequences used for our products are proprietary and cannot be disclosed. In these instances we try to provide a reasonable amino acid range to help in your decision.

Secondary Antibodies


Isotype Controls

Additional FTO Products

Bioinformatics Tool for FTO Antibody (NBP1-69021)

Discover related pathways, diseases and genes to FTO Antibody (NBP1-69021). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FTO Antibody (NBP1-69021)

Discover more about diseases related to FTO Antibody (NBP1-69021).

Pathways for FTO Antibody (NBP1-69021)

View related products by pathway.

PTMs for FTO Antibody (NBP1-69021)

Learn more about PTMs related to FTO Antibody (NBP1-69021).

Blogs on FTO

There are no specific blogs for FTO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FTO Antibody and receive a gift card or discount.


Gene Symbol FTO