FTO Antibody

Western Blot: FTO Antibody [NBP1-69021] - Mouse Brain lysate, concentration 0.2-1 ug/ml.

Product Discontinued

FTO Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to Fto (fat mass and obesity associated) The peptide sequence was selected from the N terminal of Fto. Peptide sequence MKRVQTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FTO
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunoprecipitation
  • Western Blot 1.0 ug/ml
• Theoretical MW: 58 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FTO Antibody

• Alpha-ketoglutarate-dependent dioxygenase FTO
• EC 1.14.11.-
• fat mass and obesity associated
• Fat mass and obesity-associated protein
• FTO
• KIAA1752protein fto
• MGC5149

Background

Fto is a dioxygenase that repairs alkylated DNA and RNA by oxidative demethylation. Fto has highest activity towards single-stranded RNA containing 3-methyluracil, followed by single-stranded DNA containing 3-methylthymine. Fto has low demethylase activity towards single-stranded DNA containing 1-methyladenine or 3-methylcytosine. Fto has no activity towards 1-methylguanine and no detectable activity towards double-stranded DNA. Fto requires molecular oxygen, alpha-ketoglutarate and iron. Fto contributes to the regulation of the global metabolic rate, energy expenditure and energy homeostasis. Fto contributes to the regulation of body size and body fat accumulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FTO Antibody (NBP1-69021)(1)

Publication using NBP1-69021

• Su X, Shen Y, Jin Y Et al. Aging-Associated Differences in Epitranscriptomic m6A Regulation in Response to Acute Cardiac Ischemia/Reperfusion Injury in Female Mice Frontiers in pharmacology 2021-08-03 [PMID: 34413770] (WB, Mouse)

FAQs for FTO Antibody (NBP1-69021). (Showing 1 - 1 of 1 FAQ).

1. Do you have any antibodies against FTO, where you can indicate the sequence of the immunogen?
   • With regards to other FTO antibodies that we do list the peptide sequence for, the immunogen sequence for catalog number NB110-60935 can be found in the range of amino acids 400-505. Many of the exact immunogen sequences used for our products are proprietary and cannot be disclosed. In these instances we try to provide a reasonable amino acid range to help in your decision.

Bioinformatics

• Gene Symbol: FTO
• Uniprot:
  • Q8BGW1(Mouse)