FPRL1/FPR2 Antibody (2H7)


Western Blot: FPRL1/FPR2 Antibody (2H7) [H00002358-M04] - Analysis of FPR2 expression in HeLa.
Sandwich ELISA: FPRL1/FPR2 Antibody (2H7) [H00002358-M04] - (Recombinant Protein)

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

FPRL1/FPR2 Antibody (2H7) Summary

FPR2 (AAH29125.1 163 a.a. - 205 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR
FPRL1 - formyl peptide receptor-like 1 (2H7)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FPRL1/FPR2 Antibody (2H7)

  • ALXR
  • FMLP-R-I
  • formyl peptide receptor 2
  • Formyl peptide receptor-like 1RFP
  • FPR2
  • FPR2A
  • FPRH1FMLP-related receptor I
  • FPRL1
  • FPRL1LXA4 receptor
  • HM63
  • HM63FPRH2
  • lipoxin A4 receptor (formyl peptide receptor related)
  • Lipoxin A4 receptor
  • LXA4 Receptor
  • N-formyl peptide receptor 2
  • RFP


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Pm
Applications: WB, Simple Western
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P

Publications for FPRL1/FPR2 Antibody (H00002358-M04) (0)

There are no publications for FPRL1/FPR2 Antibody (H00002358-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FPRL1/FPR2 Antibody (H00002358-M04) (0)

There are no reviews for FPRL1/FPR2 Antibody (H00002358-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FPRL1/FPR2 Antibody (H00002358-M04). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for an FPRL1 antibody that is reactive to mouse only. Does Novus have the antibody in question?
    • To answer your question, unfortunately all our FPRL1 antibodies are polyclonal and would detect both mouse and human formyl peptide receptor-like-1 and we do not have any mouse monoclonal antibody for it.

Secondary Antibodies


Isotype Controls

Additional FPRL1/FPR2 Products

Bioinformatics Tool for FPRL1/FPR2 Antibody (H00002358-M04)

Discover related pathways, diseases and genes to FPRL1/FPR2 Antibody (H00002358-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FPRL1/FPR2 Antibody (H00002358-M04)

Discover more about diseases related to FPRL1/FPR2 Antibody (H00002358-M04).

Pathways for FPRL1/FPR2 Antibody (H00002358-M04)

View related products by pathway.

PTMs for FPRL1/FPR2 Antibody (H00002358-M04)

Learn more about PTMs related to FPRL1/FPR2 Antibody (H00002358-M04).

Research Areas for FPRL1/FPR2 Antibody (H00002358-M04)

Find related products by research area.

Blogs on FPRL1/FPR2

There are no specific blogs for FPRL1/FPR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FPRL1/FPR2 Antibody (2H7) and receive a gift card or discount.


Gene Symbol FPR2