FOXRED2 Antibody

Images

 
Western Blot: FOXRED2 Antibody [NBP1-82084] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry: FOXRED2 Antibody [NBP1-82084] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FOXRED2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CVLGAGPAGLQMAYFLQRAGRDYAVFERAPRPGSFFTRYPRHRKLISINKRYTGKANAEFNLRHDWNSLLSHDPRLLFRHYSRAYFPDARDMVRYLGDFADTLGLRVQYNTTIAHVTLDKDRQAWNGHYFILTDQKG
Specificity
Specificity of human FOXRED2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOXRED2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FOXRED2 Protein (NBP1-82084PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FOXRED2 Antibody

  • Endoplasmic reticulum flavoprotein associated with degradation
  • ERFAD
  • FAD-dependent oxidoreductase domain containing 2
  • FAD-dependent oxidoreductase domain-containing protein 2
  • FLJ23322
  • FLJ33734

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00054431-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-519
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81623
Species: Hu
Applications: IHC, IHC-P
NBP1-76801
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB100-61071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-517
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, B/N
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82084
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FOXRED2 Antibody (NBP1-82084) (0)

There are no publications for FOXRED2 Antibody (NBP1-82084).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXRED2 Antibody (NBP1-82084) (0)

There are no reviews for FOXRED2 Antibody (NBP1-82084). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FOXRED2 Antibody (NBP1-82084) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for FOXRED2 Antibody (NBP1-82084)

Discover related pathways, diseases and genes to FOXRED2 Antibody (NBP1-82084). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOXRED2 Antibody (NBP1-82084)

Discover more about diseases related to FOXRED2 Antibody (NBP1-82084).
 

Pathways for FOXRED2 Antibody (NBP1-82084)

View related products by pathway.

Blogs on FOXRED2

There are no specific blogs for FOXRED2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FOXRED2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXRED2