Recombinant Human FOXR1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FOXR1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 99 of Human FOXR1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGNELFLAFTTSHLPLAEQKLARYKLRIVKPPKLPLEKKPNPDKDGPDYEPNLWMWVNPNIVYPPGKLEVSGRRKREDLTSTLPSSQPPQKEEDASCSE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
FOXR1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FOXR1 Protein

  • DLNB13
  • Forkhead box protein N5
  • forkhead box R1 variant 1
  • forkhead box R1
  • FOXN5forkhead box protein R1
  • MGC149486

Background

This gene encodes a member of the forkhead box (FOX) family of transcription factors. FOX family members are monomeric, helix-turn-helix proteins with a core DNA-binding domain of approximately 110 aa. Many FOX transcription factors play roles in determining cell fates during early development. This forkhead box protein lacks the C-terminal basic region found in many other FOX family members. It is located within the 11q23.3 region which is commonly deleted in neuroblastomas. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00139628-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-38866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83153
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-88147
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-47453
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NB600-248
Species: Hu
Applications: WB, IP
NBP2-14401
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-23665
Species: Mu
Applications: WB
NBP1-90450
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF3445
Species: Mu
Applications: WB, IHC
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-14350
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6366
Species: Hu
Applications: WB, IHC
NBP2-41158
Species: Hu, Mu
Applications: WB, ELISA
AF4798
Species: Hu, Mu
Applications: WB
NBP1-56594
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85801
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P

Publications for FOXR1 Partial Recombinant Protein (H00283150-Q01) (0)

There are no publications for FOXR1 Partial Recombinant Protein (H00283150-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXR1 Partial Recombinant Protein (H00283150-Q01) (0)

There are no reviews for FOXR1 Partial Recombinant Protein (H00283150-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FOXR1 Partial Recombinant Protein (H00283150-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FOXR1 Products

FOXR1 H00283150-Q01

Bioinformatics Tool for FOXR1 Partial Recombinant Protein (H00283150-Q01)

Discover related pathways, diseases and genes to FOXR1 Partial Recombinant Protein (H00283150-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOXR1 Partial Recombinant Protein (H00283150-Q01)

Discover more about diseases related to FOXR1 Partial Recombinant Protein (H00283150-Q01).
 

Pathways for FOXR1 Partial Recombinant Protein (H00283150-Q01)

View related products by pathway.

Blogs on FOXR1

There are no specific blogs for FOXR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FOXO3 Antibody
NBP2-16521

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FOXR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXR1