Recombinant Human FOXR1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human FOXR1 Protein [H00283150-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human FOXR1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-99 of Human FOXR1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGNELFLAFTTSHLPLAEQKLARYKLRIVKPPKLPLEKKPNPDKDGPDYEPNLWMWVNPNIVYPPGKLEVSGRRKREDLTSTLPSSQPPQKEEDASCSE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FOXR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FOXR1 GST (N-Term) Protein

  • DLNB13
  • Forkhead box protein N5
  • forkhead box R1 variant 1
  • forkhead box R1
  • FOXN5forkhead box protein R1
  • MGC149486

Background

This gene encodes a member of the forkhead box (FOX) family of transcription factors. FOX family members are monomeric, helix-turn-helix proteins with a core DNA-binding domain of approximately 110 aa. Many FOX transcription factors play roles in determining cell fates during early development. This forkhead box protein lacks the C-terminal basic region found in many other FOX family members. It is located within the 11q23.3 region which is commonly deleted in neuroblastomas. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00139628-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-38866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83153
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1285
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA, WB
NBP3-09250
Species: Hu
Applications: WB
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-14401
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7295
Species: Mu
Applications: IHC
NBP2-88047
Species: Hu
Applications: WB
NB100-614
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, IP, KD, KO, WB
AF3445
Species: Mu
Applications: IHC, WB
NBP2-45269
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF4967
Species: Hu
Applications: WB
NBP1-83109
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-41158
Species: Hu, Mu
Applications: ELISA, ICC, WB
AF4798
Species: Hu, Mu
Applications: WB
NBP1-56594
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-85801
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84671
Species: Hu
Applications: IHC, IHC-P, WB
H00283150-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for FOXR1 Partial Recombinant Protein (H00283150-Q01) (0)

There are no publications for FOXR1 Partial Recombinant Protein (H00283150-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXR1 Partial Recombinant Protein (H00283150-Q01) (0)

There are no reviews for FOXR1 Partial Recombinant Protein (H00283150-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FOXR1 Partial Recombinant Protein (H00283150-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FOXR1 Products

Bioinformatics Tool for FOXR1 Partial Recombinant Protein (H00283150-Q01)

Discover related pathways, diseases and genes to FOXR1 Partial Recombinant Protein (H00283150-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOXR1 Partial Recombinant Protein (H00283150-Q01)

Discover more about diseases related to FOXR1 Partial Recombinant Protein (H00283150-Q01).
 

Pathways for FOXR1 Partial Recombinant Protein (H00283150-Q01)

View related products by pathway.

Blogs on FOXR1

There are no specific blogs for FOXR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FOXO3 Antibody
NB100-614

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FOXR1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXR1