Home » FosB/G0S3 » FosB/G0S3 Proteins » FosB/G0S3 Recombinant Protein Antigen

FosB/G0S3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for FosB/G0S3 Recombinant Protein Antigen (NBP2-56210PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

FosB/G0S3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FosB/G0S3.

Source: E.coli

Amino Acid Sequence: LPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAF
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FOSB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-56210 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for FosB/G0S3 Recombinant Protein Antigen

  • activator protein 1
  • AP-1
  • DKFZp686C0818
  • FBJ murine osteosarcoma viral oncogene homolog B
  • FosB
  • G0S3
  • G0S3G0/G1 switch regulatory protein 3
  • GOS3
  • GOSB
  • MGC42291
  • oncogene FOS-B
  • protein fosB

Background

Fos and Jun dimerize to form Activator Protein-1 (AP-1), a transcriptional factor that binds to the 12-O-tetradecanoylphorbol 13-acetate (TPA) response element (TRE) of several cellular and viral genes including human collagenase, metallothionein IIa, stromelysin, interleukin 2, SV40 and polyoma. Fos and Jun contain the 'leucine-zipper' motif that allows for dimerization and an adjacent basic domain required for biological activity. The functionally active form of Fos is in a heterodimer with a member of the Jun family. While Jun family members can form functional homodimers, studies indicate that Fos family members do not self-associate and therefore do not bind DNA on their own. The various dimers differ in their ability to transactivate AP-1 dependent genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western blot shows lysates of HEK293T human embryonic kidney cell line untreated (-) or treated (+) with 20 mJ/cm2 ultraviolet light (UV) with a 30 minute recovery. PVDF membrane was probed with 0.5 μg/mL of Rabbit Anti-Human Phospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-c‑Jun (S63) at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
c‑Junphosphorylated at S63 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line treated with Anisomycin using Rabbit Anti-HumanPhospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) at 1 μg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HEK293T human embryonic kidney cell line untreated (-) or treated (+) with 20 mJ/cm2 ultraviolet light (UV) with a 30 minute recovery, loaded at 0.2 mg/mL. A specific band was detected for Phospho-c‑Jun (S63) at approximately 49 kDa (as indicated) using 5 μg/mL of Rabbit Anti-Human Phospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Section of rat hippocampus stained with mouse monoclonal antibody to c-FOS NBP2-50037 in red and counterstained with rabbit polyclonal antibody to FOX3/NeuN. DAPI reveals nuclei of neurons and glia in blue. The hippocampal neurons stain green for FOX3/NeuN and a few also are expressing c-FOS, and so appear orange. These cells were spontaneously active at the time the animal was sacrificed.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Left: NBP2-50037 staining (green) in HeLa cells, which were treated with serum-starvation for 36 hrs, followed by 2 hrs 20% FBS stimulation (bottom), or PBS treatment (top). Green c-Fos staining only localizes in the nuclei of stimulated cells, but not in un-stimulated cells. Cells are counter-stained with chicken pAb against Vimentin (NB300-223, red). Blue shows DAPI staining of nucleus. Middle: Mouse brain section (45 uM; fixed by transcardial perfusion with 4% PFA) labeled with NBP2-50037 using a standard HRP-DAB staining technique. Cells expressing c-Fos show dark color in nucleus. Right: Mouse cortical section labeled with NBP2-50037 (red) and rabbit polyclonal anti-NeuN (NBP1-92716, green) using IF confocal. Neurons positive for c-Fos and RBFOX3/NeuN appear to be yellow. Inset shows an enlarged image of NBP2-50037 staining. Nuclei are labeled with Dapi (blue).
(1 Review)
(13 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on Jurkat cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on HeLa cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U2-OS cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
ERK2 Antibody
(OTI6E5)
NBP1-47842
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Endometrium tissue within the normal limits using antiMAPK1mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100C for 10min,Dilution 1:50)
Immunoprecipitation: ERK2 Antibody (6E5) [NBP1-47842] - TrueMab monoclonal anti-ERK2 antibody (Negative control: IP without adding anti-ERK2 antibody). For each experiment, 500ul of DDK tagged ERK2 overexpression lysates (at 1:5 dilution with HEK293T lysate), 2ug of antibody.
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-ERK2 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(739 Publications)
Species: Hu
Applications: BA
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western blot shows lysates of CHP-100 human neuroblastoma cell line, C6 rat glioma cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa and 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
Western blot shows recombinant human JNK1, JNK2, and JNK3 (1 ng/lane). PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
JNK1 was detected in immersion fixed MCF‑7 human breast cancer cell line using Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows 25 ng of Recombinant Human EphB2 Fc Chimera (Catalog # 5189-B2) and Recombinant Mouse EphB2 Fc Chimera (Catalog # 467-B2). PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for EphB2 at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
EphB2 was detected in immersion fixed MBA‑MB‑468 human breast cancer cell line using Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(5 Reviews)
(41 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
IL-6 [HRP]
D6050
(700 Publications)
Species: Hu
Applications: ELISA
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(4 Reviews)
(349 Publications)
Species: Hu
Applications: BA
p38 alpha Antibody
[Unconjugated]
AF8691
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for p38 alpha at approximately 43 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8691). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HEK293T human embryonic kidney parental cell line and p38 alpha knockout HEK293T cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8691) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for p38 alpha at approximately 38 kDa (as indicated) in the parental HEK293T cell line, but is not detectable in knockout HEK293T cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Orexin B, p38 alpha , and Integrin  beta 1 were detected in perfusion fixed frozen sections of mouse brainstem using Human Orexin B Monoclonal Antibody (red; Catalog # MAB734), Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (green; Catalog # AF8691), and Mouse Integrin  beta 1 Antigen Affinity-purified Polyclonal Antibody (blue; Catalog # AF2405). Tissue was incubated with primary antibodies overnight at 4 °C. Tissue was stained using NorthernLights™ 493-conjugated Anti-Rabbit IgG Secondary Antibody (green; Catalog # NL006), NorthernLights 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007), and NorthernLights 637-conjugated Anti-Goat IgG Secondary Antibody (blue; Catalog # NL002). The image of Integrin beta 1 is pseudo-colored for presentation. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
GRAP2 Antibody
(OTI1G2)
NBP2-00764
Flow Cytometry: GRAP2 Antibody (1G2) [NBP2-00764] - Analysis of Jurkat cells, using anti-GRAP2 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: GRAP2 Antibody (1G2) [NBP2-00764] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-GRAP2 antibody, and then analyzed by flow cytometry.
Western Blot: GRAP2 Antibody (1G2) [NBP2-00764] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY GRAP2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-GRAP2.
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Crk Antibody
(3G11E8)
NBP2-37568
ELISA: Crk Antibody (3G11E8) [NBP2-37568] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: Crk Antibody (3G11E8) [NBP2-37568] - Western blot analysis using CRK mAb against human CRK (AA: 1-204) recombinant protein. (Expected MW is 48.4 kDa)
Western Blot: Crk Antibody (3G11E8) [NBP2-37568] - Western blot analysis using CRK mAb against HEK293 (1) and CRK(AA: 1-204)-hIgGFc transfected HEK293 (2) cell lysate.
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AIMP2 Antibody
NBP1-81575
Immunohistochemistry-Paraffin: AIMP2 Antibody [NBP1-81575] - Staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: AIMP2 Antibody [NBP1-81575] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: AIMP2 Antibody [NBP1-81575] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
POLDIP2 Antibody
NBP1-68874
Western Blot: POLDIP2 Antibody [NBP1-68874] - Staining of K562 (A), MCF7 (B) and Mouse Liver (C) lysates (35ug protein in RIPA buffer). Primary incubation was overnight at 4C. Detected by chemiluminescence.
Western Blot: POLDIP2 Antibody [NBP1-68874] - (1ug/ml) Analysis of MCF7 lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
AHSA1 Antibody
(1A2-A8)
H00010598-M01
Western Blot: AHSA1 Antibody (1A2-A8) [H00010598-M01] - AHSA1 monoclonal antibody (M01), clone 1A2-A8 Analysis of AHSA1 expression in HepG2.
Sandwich ELISA: AHSA1 Antibody (1A2-A8) [H00010598-M01] - Detection limit for recombinant GST tagged AHSA1 is 3 ng/ml as a capture antibody.
(6 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
FRA-1/FOSL1
Antibody (OTI12F9)
NBP1-47757
Immunohistochemistry-Paraffin: FRA-1/FOSL1 Antibody (12F9) [NBP1-47757] - Staining of paraffin-embedded Adenocarcinoma of breast tissue using anti-FOSL1 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: FRA-1/FOSL1 Antibody (12F9) [NBP1-47757] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-FOSL1 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: FRA-1/FOSL1 Antibody (12F9) [NBP1-47757] - Staining of paraffin-embedded Adenocarcinoma of ovary tissue using anti-FOSL1 mouse monoclonal antibody.
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
CREB [p Ser133]
[Biotin]
DYC2510-2
A lysate prepared from HeLa human cervical epithelial carcinoma cells treated with 200 nM PMA for 20 minutes was analyzed with this DuoSet IC ELISA. The Human/Mouse/Rat Phospho-CREB (S133) DuoSet IC Detection Antibody was either untreated (no peptide) or pre-incubated with a phosphopeptide containing the CREB S133 phosphorylation site, a phosphopeptide containing the GSK-3 beta S9 phosphorylation site, a phosphopeptide containing the c-Jun S63 phosphorylation site, or a phosphopeptide containing the Raf1 S338 phosphorylation site. Peptides were used at 40 ng/mL. Only the phosphopeptide containing the CREB S133 phosphorylation site blocks the signal, indicating that the DuoSet IC ELISA is specific for CREB phosphorylation at S133.
Lysates prepared from HeLa human cervical epithelial carcinoma cells either uninduced or induced with 200 nM PMA for the indicated times were quantified with this DuoSet IC ELISA. The same lysates were also immunoblotted (inset) with either Anti-Human Phospho-CREB (S133) (Catalog # AF2510) or Anti-Human CREB (Catalog # AF2989) Polyclonal Antibodies. The DuoSet IC ELISA results correlate well with the amounts of phosphorylated CREB detected by Western blot. The immunoblot with anti-CREB antibody indicates that total levels of human CREB remained constant during incubation with PMA.The quantification of phosphorylated CREB with this DuoSet IC ELISA was also determined using cells pretreated with two concentrations of the MEK inhibitor U0126, which indirectly inhibits phosphorylation of CREB at S133.
HeLa human cervical epithelial carcinoma cells were untreated or treated with 200 nM PMA for 20 minutes, either with or without U0126 at the indicated concentrations. Cells were lysed and CREB phosphorylated at S133 was quantified with this DuoSet IC ELISA. The same lysates were also immunoblotted (inset) with either anti-phospho-CREB (S133) or anti-CREB antibodies. The DuoSet IC ELISA results correlate well with the amounts of phosphorylated CREB detected by Western blot. The immunoblot with anti-CREB antibody indicates that total levels of human CREB remained constant during the various treatments.The Phospho-CREB (S133) DuoSet IC ELISA also quantifies phosphorylated CREB levels in mouse and rat cell lysates.
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
CXCL8/IL-8
Antibody (6217) [Unco ...
MAB208
Recombinant Human IL-8/CXCL8 (Catalog # 208-IL) chemoattracts the BaF3 mouse pro‑B cell line transfected with human CXCR2 in a dose-dependent manner (orange line). The amount of cells that migrated through to the lower chemotaxis chamber was measured by Resazurin (Catalog # AR002). Chemotaxis elicited by Recombinant Human IL-8/CXCL8 (20 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human IL-8/CXCL8 Monoclonal Antibody (Catalog # MAB208). The ND50 is typically0.08-0.4 µg/mL.
IL-8/CXCL8 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Mouse Anti-Human IL-8/CXCL8 Monoclonal Antibody (Catalog # MAB208) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(1 Review)
(108 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
FosB/G0S3
Recombinant Protein A
NBP2-56210PEP
FosB/G0S3 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for FosB/G0S3 Recombinant Protein Antigen (NBP2-56210PEP) (0)

There are no publications for FosB/G0S3 Recombinant Protein Antigen (NBP2-56210PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FosB/G0S3 Recombinant Protein Antigen (NBP2-56210PEP) (0)

There are no reviews for FosB/G0S3 Recombinant Protein Antigen (NBP2-56210PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FosB/G0S3 Recombinant Protein Antigen (NBP2-56210PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FosB/G0S3 Products

Bioinformatics Tool for FosB/G0S3 Recombinant Protein Antigen (NBP2-56210PEP)

Discover related pathways, diseases and genes to FosB/G0S3 Recombinant Protein Antigen (NBP2-56210PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FosB/G0S3 Recombinant Protein Antigen (NBP2-56210PEP)

Discover more about diseases related to FosB/G0S3 Recombinant Protein Antigen (NBP2-56210PEP).
 

Pathways for FosB/G0S3 Recombinant Protein Antigen (NBP2-56210PEP)

View related products by pathway.

PTMs for FosB/G0S3 Recombinant Protein Antigen (NBP2-56210PEP)

Learn more about PTMs related to FosB/G0S3 Recombinant Protein Antigen (NBP2-56210PEP).
 

Research Areas for FosB/G0S3 Recombinant Protein Antigen (NBP2-56210PEP)

Find related products by research area.

Blogs on FosB/G0S3

There are no specific blogs for FosB/G0S3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FosB/G0S3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol FOSB