FNBP1L Antibody (1E6) Summary
Immunogen |
FNBP1L (NP_060207.2, 175 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LNLRTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERK |
Specificity |
This product is specific for Human FNBP1L monoclonal antibody (M01), clone 1E6 [Gene ID: 54874]. |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
FNBP1L |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot
|
Application Notes |
Mouse monoclonal antibody raised against a partial recombinant FNBP1L. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for FNBP1L Antibody (1E6)
Background
The protein encoded by the FNBP1L gene binds to both CDC42 and N-WASP. This protein promotes CDC42-induced actin polymerization by activating the N-WASP-WIP complex and, therefore, is involved in a pathway that links cell surface signals to the actin cytoskeleton. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Pm, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Publications for FNBP1L Antibody (H00054874-M01) (0)
There are no publications for FNBP1L Antibody (H00054874-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FNBP1L Antibody (H00054874-M01) (0)
There are no reviews for FNBP1L Antibody (H00054874-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FNBP1L Antibody (H00054874-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FNBP1L Products
Bioinformatics Tool for FNBP1L Antibody (H00054874-M01)
Discover related pathways, diseases and genes to FNBP1L Antibody (H00054874-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for FNBP1L Antibody (H00054874-M01)
Discover more about diseases related to FNBP1L Antibody (H00054874-M01).
| | Pathways for FNBP1L Antibody (H00054874-M01)
View related products by pathway.
|
PTMs for FNBP1L Antibody (H00054874-M01)
Learn more about PTMs related to FNBP1L Antibody (H00054874-M01).
| | Research Areas for FNBP1L Antibody (H00054874-M01)
Find related products by research area.
|
Blogs on FNBP1L