FNBP1L Antibody (1E6) - Azide and BSA Free

Western Blot: FNBP1L Antibody (1E6) [H00054874-M01] - FNBP1L monoclonal antibody (M01), clone 1E6. Analysis of FNBP1L expression in HepG2.

Sandwich ELISA: FNBP1L Antibody (1E6) [H00054874-M01] - Detection limit for recombinant GST tagged FNBP1L is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1E6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FNBP1L Antibody (1E6) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse FNBP1L Antibody (1E6) - Azide and BSA Free (H00054874-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: FNBP1L (NP_060207.2, 175 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LNLRTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERK
• Specificity: This product is specific for Human FNBP1L monoclonal antibody (M01), clone 1E6 [Gene ID: 54874].
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FNBP1L
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Mouse monoclonal antibody raised against a partial recombinant FNBP1L.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FNBP1L Antibody (1E6) - Azide and BSA Free

• C1orf39
• chromosome 1 open reading frame 39
• FLJ20275
• formin binding protein 1-like
• formin-binding protein 1-like
• toca-1
• TOCA1Transducer of Cdc42-dependent actin assembly protein 1
• transducer of Cdc42-dependent actin assembly 1

Background

The protein encoded by the FNBP1L gene binds to both CDC42 and N-WASP. This protein promotes CDC42-induced actin polymerization by activating the N-WASP-WIP complex and, therefore, is involved in a pathway that links cell surface signals to the actin cytoskeleton. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FNBP1L
• Uniprot:
  • NP_060207.2(Human)