Recombinant Human FKBP7 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FKBP7 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-222 of Human FKBP7 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
FKBP7
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FKBP7 Protein

  • EC 5.2.1.8
  • FK506 binding protein 7
  • FK506-binding protein 7FK506-binding protein 23,23 kDa FK506-binding protein
  • FKBP-23
  • FKBP23PPIase
  • FKBP-7
  • MGC9420
  • peptidyl-prolyl cis-trans isomerase FKBP7,23 kDa FKBP
  • PPIase FKBP7
  • rotamase

Background

The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. Members of this family exhibit PPIase activity and function as molecular chaperones. A similar protein in mouse is located in the endoplasmic reticulum and binds calcium. FKBP7( AAH09711, 1 a.a. - 223 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-57062
Species: Hu
Applications: WB, ICC/IF
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
MAB3777
Species: Hu, Mu, Rt
Applications: WB
MAB7670
Species: Hu
Applications: WB, ICC
MAB2294
Species: Hu, Mu
Applications: WB, IHC, IP
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB120-3562
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-19117
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-97946
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45861
Species: Hu
Applications: WB, Flow, IHC, IF
NBP2-58661
Species: Hu
Applications: IHC-P
AF1543
Species: Hu
Applications: WB, IHC
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB600-1397
Species: Hu, Bv, Ca, Mk, Rb
Applications: WB, Flow, IHC, IHC-P, IP, MiAr, CyTOF-ready, Flow-IC
H00051661-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for FKBP7 Recombinant Protein (H00051661-P01) (0)

There are no publications for FKBP7 Recombinant Protein (H00051661-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FKBP7 Recombinant Protein (H00051661-P01) (0)

There are no reviews for FKBP7 Recombinant Protein (H00051661-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FKBP7 Recombinant Protein (H00051661-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FKBP7 Products

Bioinformatics Tool for FKBP7 Recombinant Protein (H00051661-P01)

Discover related pathways, diseases and genes to FKBP7 Recombinant Protein (H00051661-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for FKBP7 Recombinant Protein (H00051661-P01)

View related products by pathway.

PTMs for FKBP7 Recombinant Protein (H00051661-P01)

Learn more about PTMs related to FKBP7 Recombinant Protein (H00051661-P01).

Blogs on FKBP7

There are no specific blogs for FKBP7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FKBP7 Antibody
NBP1-83889

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FKBP7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FKBP7