Recombinant Human Filensin GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Filensin Protein [H00000631-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Filensin GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 567-664 of Human Filensin

Source: Wheat Germ (in vitro)

Amino Acid Sequence: EESRRPCAMVTPGAEEPSIPEPPKPAADQDGAEVLGTRSRSLPEKGPPKALAYKTVEVVESIEKISTESIQTYEETAVIVETMIGKTKSDKKKSGEKS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
BFSP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Filensin GST (N-Term) Protein

  • Beaded filament structural protein 1
  • beaded filament structural protein 1, filensin
  • CP115Lens intermediate filament-like heavy
  • filensin
  • Lens fiber cell beaded-filament structural protein CP 115
  • LIFL-H115 KD

Background

BFSP1 - beaded filament structural protein 1, filensin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46573
Species: Hu, Rt
Applications: IHC, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-92773
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF3844
Species: Hu, Mu
Applications: IHC
NBP2-46573
Species: Hu, Rt
Applications: IHC, WB
NBP2-45861
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, WB
NB600-1397
Species: Bv, Ca, Hu, Pm, Mu, Rb
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP2-24551
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
233-FB/CF
Species: Hu
Applications: BA
NBP2-46354
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, WB
NBP2-26245
Species: Hu, Mu
Applications: Flow, In vitro
NBP2-22522
Species: Hu, Mu, Rt, Xp
Applications: WB
NBP1-88498
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
DPI00
Species: Hu
Applications: ELISA
MAB5695
Species: Hu, Mu
Applications: WB

Publications for Filensin Partial Recombinant Protein (H00000631-Q01) (0)

There are no publications for Filensin Partial Recombinant Protein (H00000631-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Filensin Partial Recombinant Protein (H00000631-Q01) (0)

There are no reviews for Filensin Partial Recombinant Protein (H00000631-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Filensin Partial Recombinant Protein (H00000631-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Filensin Products

Bioinformatics Tool for Filensin Partial Recombinant Protein (H00000631-Q01)

Discover related pathways, diseases and genes to Filensin Partial Recombinant Protein (H00000631-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Filensin Partial Recombinant Protein (H00000631-Q01)

Discover more about diseases related to Filensin Partial Recombinant Protein (H00000631-Q01).
 

Pathways for Filensin Partial Recombinant Protein (H00000631-Q01)

View related products by pathway.

Research Areas for Filensin Partial Recombinant Protein (H00000631-Q01)

Find related products by research area.

Blogs on Filensin

There are no specific blogs for Filensin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Filensin GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BFSP1