Recombinant Human FIGN Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FIGN Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 77-170 of Human FIGN partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GILEGPVDRPVLSNYSDTPSGLVNGRKNESEPWQPSLNSEAVYPMNCVPDVITASKAGVSSALPPADVSASIGSSPGVASNLTEPSYSSSTCGS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
FIGN
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FIGN Protein

  • fidgetin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47456
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89483
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32719
Species: Hu
Applications: WB, ICC/IF
NBP1-79139
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-58788
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP2-31979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59007
Species: Hu, Mu
Applications: WB
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-58511
Species: Hu
Applications: ICC/IF, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FIGN Partial Recombinant Protein (H00055137-Q01) (0)

There are no publications for FIGN Partial Recombinant Protein (H00055137-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FIGN Partial Recombinant Protein (H00055137-Q01) (0)

There are no reviews for FIGN Partial Recombinant Protein (H00055137-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FIGN Partial Recombinant Protein (H00055137-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FIGN Products

Bioinformatics Tool for FIGN Partial Recombinant Protein (H00055137-Q01)

Discover related pathways, diseases and genes to FIGN Partial Recombinant Protein (H00055137-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FIGN Partial Recombinant Protein (H00055137-Q01)

Discover more about diseases related to FIGN Partial Recombinant Protein (H00055137-Q01).
 

Pathways for FIGN Partial Recombinant Protein (H00055137-Q01)

View related products by pathway.

Blogs on FIGN

There are no specific blogs for FIGN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FIGN Antibody
NBP1-86313

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FIGN Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FIGN