Fibroblast Activation Protein alpha/FAP Antibody (2F2)

Images

 
There are currently no images for Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2F2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Fibroblast Activation Protein alpha/FAP Antibody (2F2) Summary

Immunogen
FAP (AAH26250 525 a.a. - 624 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWS
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FAP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Fibroblast Activation Protein alpha/FAP Antibody (2F2)

  • 170 kDa melanoma membrane-bound gelatinase
  • DKFZp686G13158
  • DPPIV
  • EC 3.4.21.-
  • FAP
  • FAPA
  • Fibroblast Activation Protein alpha
  • fibroblast activation protein, alpha
  • Integral membrane serine protease
  • Seprase
  • vibronectin

Background

The protein encoded by this gene is a homodimeric integral membrane gelatinase belonging to the serine protease family. It is selectively expressed in reactive stromal fibroblasts of epithelial cancers, granulation tissue of healing wounds, and malignant cells of bone and soft tissue sarcomas. This protein is thought to be involved in the control of fibroblast growth or epithelial-mesenchymal interactions during development, tissue repair, and epithelial carcinogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB100-621
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-56552
Species: Hu
Applications: WB
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-84993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-01521
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB600-1032
Species: Hu, Mu, Rt, Ba
Applications: WB, ICC/IF, IHC
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M02) (0)

There are no publications for Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M02) (0)

There are no reviews for Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fibroblast Activation Protein alpha/FAP Products

Bioinformatics Tool for Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M02)

Discover related pathways, diseases and genes to Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M02)

Discover more about diseases related to Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M02).
 

Pathways for Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M02)

View related products by pathway.

PTMs for Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M02)

Learn more about PTMs related to Fibroblast Activation Protein alpha/FAP Antibody (H00002191-M02).

Blogs on Fibroblast Activation Protein alpha/FAP

There are no specific blogs for Fibroblast Activation Protein alpha/FAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fibroblast Activation Protein alpha/FAP Antibody (2F2) and receive a gift card or discount.

Bioinformatics

Gene Symbol FAP
Entrez
Uniprot