FGGY carbohydrate kinase domain containing Antibody

Images

 
Western Blot: FGGY carbohydrate kinase domain containing Antibody [NBP1-79275] - Mouse Kidney lysate, concentration 1 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FGGY carbohydrate kinase domain containing Antibody Summary

Immunogen
The specific Immunogen is proprietary information. Peptide sequence NETKHRVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FGGY
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against Fggy and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FGGY carbohydrate kinase domain containing Antibody

  • EC 2.7.1
  • EC 2.7.1.-
  • FGGY carbohydrate kinase domain containing
  • FGGY carbohydrate kinase domain-containing protein
  • FLJ10986

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47481
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1436
Species: Mu
Applications: WB
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-91074
Species: Hu
Applications: IHC, IHC-P
NBP1-86624
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55413
Species: Hu
Applications: WB
NB100-2466
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-89445
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FGGY carbohydrate kinase domain containing Antibody (NBP1-79275) (0)

There are no publications for FGGY carbohydrate kinase domain containing Antibody (NBP1-79275).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGGY carbohydrate kinase domain containing Antibody (NBP1-79275) (0)

There are no reviews for FGGY carbohydrate kinase domain containing Antibody (NBP1-79275). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGGY carbohydrate kinase domain containing Antibody (NBP1-79275) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for FGGY carbohydrate kinase domain containing Antibody (NBP1-79275)

Discover related pathways, diseases and genes to FGGY carbohydrate kinase domain containing Antibody (NBP1-79275). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGGY carbohydrate kinase domain containing Antibody (NBP1-79275)

Discover more about diseases related to FGGY carbohydrate kinase domain containing Antibody (NBP1-79275).
 

Pathways for FGGY carbohydrate kinase domain containing Antibody (NBP1-79275)

View related products by pathway.

Blogs on FGGY carbohydrate kinase domain containing

There are no specific blogs for FGGY carbohydrate kinase domain containing, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGGY carbohydrate kinase domain containing Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FGGY
Uniprot