Novus Biologicals products are now on bio-techne.com

Recombinant Human FGF-11 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human FGF-11 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 15-103 of Human FGF-11

Source: Wheat Germ (in vitro)

Amino Acid Sequence: VREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARPDRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTH

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FGF11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
35.53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00002256-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FGF-11 GST (N-Term) Protein

  • FGF11
  • FGF-11
  • FHF-3
  • FHF3Fibroblast growth factor homologous factor 3
  • fibroblast growth factor 11
  • FLJ16061
  • MGC102953
  • MGC45269

Background

FGF11 - fibroblast growth factor 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16471
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-04588
Species: Hu, Mu, Rt
Applications: WB
251-KG
Species: Hu
Applications: BA
345-FG
Species: Hu
Applications: BA
273-F9
Species: Hu
Applications: BA
8988-F18
Species: Hu
Applications: BA
AF232
Species: Hu
Applications: IHC, Neut, Simple Western, WB
423-F8
Species: Hu, Mu
Applications: BA
7460-F4/CF
Species: Hu
Applications: BA
1206-F3
Species: Hu
Applications: BA
233-FB
Species: Hu
Applications: BA
MAB319
Species: Hu
Applications: IHC, WB
3867-FG/CF
Species: Hu
Applications: BA
2246-FG/CF
Species: Hu
Applications: BA
2547-FG/CF
Species: Hu
Applications: BA
AF6755
Species: Mu
Applications: IHC
DVE00
Species: Hu
Applications: ELISA
7754-BH/CF
Species: Hu
Applications: BA
AF1212
Species: Hu, Mu
Applications: ICC, IHC, Neut, WB
AF6240
Species: Hu
Applications: ELISA, IHC, WB

Publications for FGF-11 Partial Recombinant Protein (H00002256-Q01)(1)

Reviews for FGF-11 Partial Recombinant Protein (H00002256-Q01) (0)

There are no reviews for FGF-11 Partial Recombinant Protein (H00002256-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGF-11 Partial Recombinant Protein (H00002256-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FGF-11 Products

Array H00002256-Q01

Research Areas for FGF-11 Partial Recombinant Protein (H00002256-Q01)

Find related products by research area.

Blogs on FGF-11

There are no specific blogs for FGF-11, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FGF-11 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FGF11