Recombinant Human FGF-11 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FGF-11 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-89 of Human FGF11 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARPDRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
FGF11
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00002256-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FGF-11 Protein

  • FGF11
  • FGF-11
  • FHF-3
  • FHF3Fibroblast growth factor homologous factor 3
  • fibroblast growth factor 11
  • FLJ16061
  • MGC102953
  • MGC45269

Background

FGF11 - fibroblast growth factor 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55745
Species: Hu
Applications: ICC/IF
NBP2-35010
Species: Hu
232-FA/CF
Species: Hu
423-F8/CF
Species: Hu, Mu
NB200-603
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
MAB319
Species: Hu
Applications: WB, IHC
3867-FG/CF
Species: Hu
2246-FG/CF
Species: Hu
2547-FG/CF
Species: Hu
AF6755
Species: Mu
Applications: IHC
AF1212
Species: Hu, Mu
Applications: WB, IHC, ICC, Neut
MAB6240
Species: Hu
Applications: WB, IHC
H00002256-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for FGF-11 Partial Recombinant Protein (H00002256-Q01)(1)

Reviews for FGF-11 Partial Recombinant Protein (H00002256-Q01) (0)

There are no reviews for FGF-11 Partial Recombinant Protein (H00002256-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGF-11 Partial Recombinant Protein (H00002256-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FGF-11 Products

FGF-11 H00002256-Q01

Bioinformatics Tool for FGF-11 Partial Recombinant Protein (H00002256-Q01)

Discover related pathways, diseases and genes to FGF-11 Partial Recombinant Protein (H00002256-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF-11 Partial Recombinant Protein (H00002256-Q01)

Discover more about diseases related to FGF-11 Partial Recombinant Protein (H00002256-Q01).
 

Pathways for FGF-11 Partial Recombinant Protein (H00002256-Q01)

View related products by pathway.

PTMs for FGF-11 Partial Recombinant Protein (H00002256-Q01)

Learn more about PTMs related to FGF-11 Partial Recombinant Protein (H00002256-Q01).
 

Research Areas for FGF-11 Partial Recombinant Protein (H00002256-Q01)

Find related products by research area.

Blogs on FGF-11

There are no specific blogs for FGF-11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FGF-11 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FGF11
Entrez