Recombinant Human Ferritin mitochondrial Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Ferritin mitochondrial Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 143 - 242 of Human FTMT partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QDIKKPEQDDWESGLHAMECALLLEKNVNQSLLELHALASDKGDPHLCDFLETYYLNEQVKSIKELGDHVHNLVKMGAPDAGLAEYLFDTHTLGNENKQN

Protein/Peptide Type
Partial Recombinant Protein
Gene
FTMT

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ferritin mitochondrial Protein

  • EC 1.16.3.1
  • ferritin H subunit
  • ferritin mitochondrial
  • ferritin, mitochondrial
  • mitochondrial ferritin
  • MtF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8175
Species: Hu
Applications: WB, Simple Western, IHC
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-40591
Species: Hu
Applications: WB, IHC-P, IP
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00990
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-61045
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1334
Species: Hu
Applications: WB, IHC
NB100-74360
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-86380
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for Ferritin mitochondrial Partial Recombinant Protein (H00094033-Q01) (0)

There are no publications for Ferritin mitochondrial Partial Recombinant Protein (H00094033-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ferritin mitochondrial Partial Recombinant Protein (H00094033-Q01) (0)

There are no reviews for Ferritin mitochondrial Partial Recombinant Protein (H00094033-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ferritin mitochondrial Partial Recombinant Protein (H00094033-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ferritin mitochondrial Products

Bioinformatics Tool for Ferritin mitochondrial Partial Recombinant Protein (H00094033-Q01)

Discover related pathways, diseases and genes to Ferritin mitochondrial Partial Recombinant Protein (H00094033-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ferritin mitochondrial Partial Recombinant Protein (H00094033-Q01)

Discover more about diseases related to Ferritin mitochondrial Partial Recombinant Protein (H00094033-Q01).
 

Pathways for Ferritin mitochondrial Partial Recombinant Protein (H00094033-Q01)

View related products by pathway.

PTMs for Ferritin mitochondrial Partial Recombinant Protein (H00094033-Q01)

Learn more about PTMs related to Ferritin mitochondrial Partial Recombinant Protein (H00094033-Q01).
 

Research Areas for Ferritin mitochondrial Partial Recombinant Protein (H00094033-Q01)

Find related products by research area.

Blogs on Ferritin mitochondrial

There are no specific blogs for Ferritin mitochondrial, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MTF1 Antibody
NBP1-86380

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Ferritin mitochondrial Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FTMT