FDPS Antibody (3A6)

Images

 
Sandwich ELISA: FDPS Antibody (3A6) [H00002224-M01] - Detection limit for recombinant GST tagged FDPS is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3A6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FDPS Antibody (3A6) Summary

Immunogen
FDPS (NP_001995.1 320 a.a. - 419 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
Specificity
Reacts with farnesyl diphosphate synthase (farnesyl pyrophosphate synthetase, dimethylallyltranstransferase, geranyltranstransferase).
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FDPS
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FDPS Antibody (3A6)

  • 6E)-farnesyl diphosphate synthase
  • Dimethylallyltranstransferase
  • EC 2.5.1.1
  • EC 2.5.1.10
  • farnesyl diphosphate synthaseFPP synthetase
  • farnesyl pyrophosphate synthase
  • farnesyl pyrophosphate synthetase, dimethylallyltranstransferase
  • FPP synthase
  • FPPS
  • FPSgeranyltranstransferase
  • Geranyltranstransferase
  • KIAA1293

Background

This gene encodes an enzyme that catalyzes the production of geranyl pyrophosphate and farnesyl pyrophosphate from isopentenyl pyrophosphate and dimethylallyl pyrophosphate. The resulting product, farnesyl pyrophosphate, is a key intermediate in cholesterol and sterol biosynthesis, a substrate for protein farnesylation and geranylgeranylation, and a ligand or agonist for certain hormone receptors and growth receptors. Drugs that inhibit this enzyme prevent the post-translational modifications of small GTPases and have been used to treat diseases related to bone resorption. Multiple pseudogenes have been found on chromosomes 1, 7, 14, 15, 21 and X. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83368
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-16984
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31475
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01170
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB6460
Species: Hu
Applications: WB, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-33908
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FDPS Antibody (H00002224-M01) (0)

There are no publications for FDPS Antibody (H00002224-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FDPS Antibody (H00002224-M01) (0)

There are no reviews for FDPS Antibody (H00002224-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FDPS Antibody (H00002224-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FDPS Products

Bioinformatics Tool for FDPS Antibody (H00002224-M01)

Discover related pathways, diseases and genes to FDPS Antibody (H00002224-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FDPS Antibody (H00002224-M01)

Discover more about diseases related to FDPS Antibody (H00002224-M01).
 

Pathways for FDPS Antibody (H00002224-M01)

View related products by pathway.

PTMs for FDPS Antibody (H00002224-M01)

Learn more about PTMs related to FDPS Antibody (H00002224-M01).
 

Research Areas for FDPS Antibody (H00002224-M01)

Find related products by research area.

Blogs on FDPS

There are no specific blogs for FDPS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FDPS Antibody (3A6) and receive a gift card or discount.

Bioinformatics

Gene Symbol FDPS
Entrez
Uniprot