FBXW12 Antibody (1A9)

Images

 
Western Blot: FBXW12 Antibody (1A9) [H00285231-M03] - Analysis of FBXW12 expression in HepG2.
Sandwich ELISA: FBXW12 Antibody (1A9) [H00285231-M03] - Detection limit for recombinant GST tagged FBXW12 is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1A9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FBXW12 Antibody (1A9) Summary

Immunogen
FBXW12 (NP_996985.1, 265 a.a. ~ 354 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LLRPSEGSDPLSTFLPHKLCASACWTPKVKNRITLMSQSSTGKKTEFITFDLTTKKTGGQTVIQAYEIASFQVAAHLKCPIWMGASDGYM
Specificity
F-box and WD repeat domain containing 12
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FBXW12
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FBXW12 Antibody (1A9)

  • F-box and WD repeat domain containing 12
  • F-box and WD-40 domain-containing protein 12
  • F-box- and WD40-repeat-containing protein
  • F-box only protein 35MGC120386
  • F-box/WD repeat-containing protein 12
  • Fbw12
  • FBW12MGC120387
  • FBXO12FBXO35F-box and WD-40 domain protein 12
  • MGC120385

Background

Members of the F-box protein family, such as FBXW12, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603034), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FBXW12 Antibody (H00285231-M03) (0)

There are no publications for FBXW12 Antibody (H00285231-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXW12 Antibody (H00285231-M03) (0)

There are no reviews for FBXW12 Antibody (H00285231-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXW12 Antibody (H00285231-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXW12 Antibody (1A9) and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXW12
Entrez
Uniprot