FBXW12 Antibody (1A9)

Western Blot: FBXW12 Antibody (1A9) [H00285231-M03] - Analysis of FBXW12 expression in HepG2.

Sandwich ELISA: FBXW12 Antibody (1A9) [H00285231-M03] - Detection limit for recombinant GST tagged FBXW12 is 3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, S-ELISA
• Clone: 1A9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

FBXW12 Antibody (1A9) Summary

• Immunogen: FBXW12 (NP_996985.1, 265 a.a. ~ 354 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LLRPSEGSDPLSTFLPHKLCASACWTPKVKNRITLMSQSSTGKKTEFITFDLTTKKTGGQTVIQAYEIASFQVAAHLKCPIWMGASDGYM
• Specificity: F-box and WD repeat domain containing 12
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FBXW12
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FBXW12 Antibody (1A9)

• F-box and WD repeat domain containing 12
• F-box and WD-40 domain-containing protein 12
• F-box- and WD40-repeat-containing protein
• F-box only protein 35MGC120386
• F-box/WD repeat-containing protein 12
• Fbw12
• FBW12MGC120387
• FBXO12FBXO35F-box and WD-40 domain protein 12
• MGC120385

Background

Members of the F-box protein family, such as FBXW12, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603034), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FBXW12
• Entrez:
  • 285231(Human)
• Uniprot:
  • NP_996985(Human)