Recombinant Human FBXO7 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FBXO7 Protein Summary

Description
FBXO7 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: AVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLP
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
FBXO7

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FBXO7 Protein

  • F-box only protein 7
  • F-box protein 7
  • FBX
  • FBX07
  • FBX7Fbx
  • PARK15DKFZp686B08113
  • PKPS

Background

FBXO7 - F-box protein 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41486
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP1-81586
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IP, In vitro
BC100-494
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PEP-ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
H00001021-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
H00005071-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-58219
Species: Hu
Applications: WB
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-02677
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82143
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-40573
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-80608
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4736
Species: Hu
Applications: WB
NB200-119
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for FBXO7 Partial Recombinant Protein (H00025793-Q01) (0)

There are no publications for FBXO7 Partial Recombinant Protein (H00025793-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXO7 Partial Recombinant Protein (H00025793-Q01) (0)

There are no reviews for FBXO7 Partial Recombinant Protein (H00025793-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXO7 Partial Recombinant Protein (H00025793-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human FBXO7 Protein Products

Related Products by Gene

Bioinformatics Tool for FBXO7 Partial Recombinant Protein (H00025793-Q01)

Discover related pathways, diseases and genes to FBXO7 Partial Recombinant Protein (H00025793-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXO7 Partial Recombinant Protein (H00025793-Q01)

Discover more about diseases related to FBXO7 Partial Recombinant Protein (H00025793-Q01).
 

Pathways for FBXO7 Partial Recombinant Protein (H00025793-Q01)

View related products by pathway.

PTMs for FBXO7 Partial Recombinant Protein (H00025793-Q01)

Learn more about PTMs related to FBXO7 Partial Recombinant Protein (H00025793-Q01).

Blogs on FBXO7

There are no specific blogs for FBXO7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FBXO7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXO7

Customers Who Bought This Also Bought

PINK1 Antibody
BC100-494
PINK1 Antibody
BC100-494
PINK1 Antibody
BC100-494
FBXO7 Antibody
H00025793-B01P
FBXO7 Antibody
H00025793-B01P
FBXO7 Antibody
H00025793-B01P