FBXO7 Partial Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

FBXO7 Partial Recombinant Protein Summary

Description
FBXO7 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: AVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLP
Preparation
Method
in vitro wheat germ expression system
Gene
FBXO7

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FBXO7 Partial Recombinant Protein

  • F-box only protein 7
  • F-box protein 7
  • FBX
  • FBX07
  • FBX7Fbx
  • PARK15DKFZp686B08113
  • PKPS

Background

FBXO7 - F-box protein 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41486
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP1-81586
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IP, In vitro
BC100-494
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PEP-ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2574
Species: Hu
Applications: ICFlow
H00001021-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA
NB100-91921
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58219
Species: Hu
Applications: WB
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-02677
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82143
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87976
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80608
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-119
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00025793-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for FBXO7 Partial Recombinant Protein (H00025793-Q01) (0)

There are no publications for FBXO7 Partial Recombinant Protein (H00025793-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXO7 Partial Recombinant Protein (H00025793-Q01) (0)

There are no reviews for FBXO7 Partial Recombinant Protein (H00025793-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXO7 Partial Recombinant Protein (H00025793-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FBXO7 Partial Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for FBXO7 Partial Recombinant Protein (H00025793-Q01)

Discover related pathways, diseases and genes to FBXO7 Partial Recombinant Protein (H00025793-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXO7 Partial Recombinant Protein (H00025793-Q01)

Discover more about diseases related to FBXO7 Partial Recombinant Protein (H00025793-Q01).
 

Pathways for FBXO7 Partial Recombinant Protein (H00025793-Q01)

View related products by pathway.

PTMs for FBXO7 Partial Recombinant Protein (H00025793-Q01)

Learn more about PTMs related to FBXO7 Partial Recombinant Protein (H00025793-Q01).

Blogs on FBXO7

There are no specific blogs for FBXO7, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol FBXO7

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00025793-Q01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

FBXO7 Recombinant Protein
H00025793-P01-2ug
PINK1 Antibody
BC100-494
PINK1 Antibody
BC100-494
PINK1 Antibody
BC100-494
FBXO7 Antibody
H00025793-B01P
FBXO7 Antibody
H00025793-B01P
FBXO7 Antibody
H00025793-B01P