Recombinant Human FBXL18 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human FBXL18 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-110 of Human FBXL18

Source: Wheat Germ

Amino Acid Sequence: MASSGEDISNDDDDMHPAAAGMADGVHLLGFSDEILLHILSHVPSTDLILNVRRTCRKLAALCLDKSLIHTVLLQKDYQASEDKVRQLVKEIGREIQQLSMAGCYWLPGS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FBXL18
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FBXL18 Protein

  • Fbl18
  • F-box and leucine-rich repeat protein 18FLJ38075
  • F-box/LRR-repeat protein 18
  • FLJ10776
  • FLJ11467
  • FLJ26934
  • FLJ41541

Background

FBXL18 - F-box and leucine-rich repeat protein 18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1289
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-29923
Species: Hu
Applications: WB, Flow
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-84720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
MAB5646
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-45693
Species: Hu
Applications: WB, IHC
NBP1-55045
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91891
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP1-83918
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27364
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P

Publications for FBXL18 Partial Recombinant Protein (H00080028-Q01) (0)

There are no publications for FBXL18 Partial Recombinant Protein (H00080028-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXL18 Partial Recombinant Protein (H00080028-Q01) (0)

There are no reviews for FBXL18 Partial Recombinant Protein (H00080028-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXL18 Partial Recombinant Protein (H00080028-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FBXL18 Products

Bioinformatics Tool for FBXL18 Partial Recombinant Protein (H00080028-Q01)

Discover related pathways, diseases and genes to FBXL18 Partial Recombinant Protein (H00080028-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXL18 Partial Recombinant Protein (H00080028-Q01)

Discover more about diseases related to FBXL18 Partial Recombinant Protein (H00080028-Q01).

Blogs on FBXL18

There are no specific blogs for FBXL18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FBXL18 Antibody (3H5)
H00080028-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FBXL18 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXL18