FASTKD1 Antibody - BSA Free

Immunohistochemistry-Paraffin: FASTKD1 Antibody [NBP2-14009] - Staining of human pancreas shows very weak cytoplasmic positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: FASTKD1 Antibody [NBP2-14009] - Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: FASTKD1 Antibody [NBP2-14009] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: FASTKD1 Antibody [NBP2-14009] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FASTKD1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FASTKD1 Antibody - BSA Free (NBP2-14009) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GSHNIALGQLPEMPWESNIEIVGSRLPPGAERIALEFLDSKALCRNIPHMKGKSAMKKRHLEILGYRVIQISQFEWNSMALSTKDA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FASTKD1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FASTKD1 Protein (NBP2-14009PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FASTKD1 Antibody - BSA Free

• FAST kinase domain-containing protein 1
• FAST kinase domains 1
• FLJ21901
• KIAA1800

Background

The FASTKD1 gene encodes a FAST kinase domain-containing protein 1 that exists in two isoforms: isoform 1 is 847 amino acids long at 97 kDA while isoform 2 is 804 amino acids long at 92 kDA. FASTKD1 is known to interact with genes AASS, ABCB7, AARS2, ICT1, and MYC. It has been linked to mitochondrial encephalomyopathy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FASTKD1