FASTKD1 Antibody

Images

 
Immunohistochemistry-Paraffin: FASTKD1 Antibody [NBP2-14009] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: FASTKD1 Antibody [NBP2-14009] - Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FASTKD1 Antibody [NBP2-14009] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: FASTKD1 Antibody [NBP2-14009] - Staining of human pancreas shows very weak cytoplasmic positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FASTKD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GSHNIALGQLPEMPWESNIEIVGSRLPPGAERIALEFLDSKALCRNIPHM KGKSAMKKRHLEILGYRVIQISQFEWNSMALSTKDA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FASTKD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FASTKD1 Protein (NBP2-14009PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FASTKD1 Antibody

  • FAST kinase domain-containing protein 1
  • FAST kinase domains 1
  • FLJ21901
  • KIAA1800

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82750
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30537
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58860
Species: Hu
Applications: ICC/IF
NBP1-84724
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89602
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
AF4979
Species: Hu
Applications: WB
NBP2-46393
Species: Hu
Applications: WB, IHC
NBP2-31683
Species: Hu
Applications: IHC, IHC-P
NBP2-38696
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-83613
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB3199
Species: Hu, Mu, Rt
Applications: WB, ICC
AF2396
Species: Hu
Applications: WB, Simple Western, IHC
H00005025-B01P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC
NBP1-86575
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55000
Species: Hu
Applications: ICC/IF
NBP1-85786
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14009
Species: Hu
Applications: IHC, IHC-P

Publications for FASTKD1 Antibody (NBP2-14009) (0)

There are no publications for FASTKD1 Antibody (NBP2-14009).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FASTKD1 Antibody (NBP2-14009) (0)

There are no reviews for FASTKD1 Antibody (NBP2-14009). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FASTKD1 Antibody (NBP2-14009) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FASTKD1 Products

Bioinformatics Tool for FASTKD1 Antibody (NBP2-14009)

Discover related pathways, diseases and genes to FASTKD1 Antibody (NBP2-14009). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FASTKD1 Antibody (NBP2-14009)

Discover more about diseases related to FASTKD1 Antibody (NBP2-14009).

Research Areas for FASTKD1 Antibody (NBP2-14009)

Find related products by research area.

Blogs on FASTKD1

There are no specific blogs for FASTKD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FASTKD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FASTKD1