FAR1 Antibody

Images

 
Western Blot: FAR1 Antibody [NBP1-89847] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: FAR1 Antibody [NBP1-89847] - Staining of human cell line RT4 shows localization to peroxisomes.
Immunohistochemistry-Paraffin: FAR1 Antibody [NBP1-89847] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YYEGKNVLLTGATGFLGKVLLEKLLRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKIIAINSELTQPKLALSEEDKEVIIDSTNIIFHCAATVRFNENLRDAVQLNVIATRQLILLAQQMKNLEVFM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAR1 Protein (NBP1-89847PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAR1 Antibody

  • fatty acyl CoA reductase 1
  • FLJ22728
  • FLJ33561
  • short chain dehydrogenase/reductase family 10E, member 1
  • UNQ2423/PRO4981

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31758
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43782
Species: Hu
Applications: WB
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
H00317705-R02
Species: Hu
NBP1-86869
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-48814
Species: Hu
Applications: IHC
NLS418
Species: Hu
Applications: IHC-P
NBP1-89847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FAR1 Antibody (NBP1-89847) (0)

There are no publications for FAR1 Antibody (NBP1-89847).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAR1 Antibody (NBP1-89847) (0)

There are no reviews for FAR1 Antibody (NBP1-89847). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAR1 Antibody (NBP1-89847) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAR1 Products

FAR1 NBP1-89847

Bioinformatics Tool for FAR1 Antibody (NBP1-89847)

Discover related pathways, diseases and genes to FAR1 Antibody (NBP1-89847). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAR1 Antibody (NBP1-89847)

Discover more about diseases related to FAR1 Antibody (NBP1-89847).
 

Pathways for FAR1 Antibody (NBP1-89847)

View related products by pathway.

PTMs for FAR1 Antibody (NBP1-89847)

Learn more about PTMs related to FAR1 Antibody (NBP1-89847).

Blogs on FAR1

There are no specific blogs for FAR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAR1