FAM131B Antibody

Images

 
Western Blot: FAM131B Antibody [NBP3-10724] - Western blot analysis of FAM131B in 721_B Whole Cell lysates. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM131B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM131B. Peptide sequence IEWQGWGKTPAVQPQHSHESVRRDTDAYSDLSDGEKEARFLAGVMEQFAI
Clonality
Polyclonal
Host
Rabbit
Gene
FAM131B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for FAM131B Antibody

  • family with sequence similarity 131, member B
  • KIAA0773hypothetical protein LOC9715

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-82956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-23368
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00003845-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
NBP1-47668
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-01763
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-37454
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-45745
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP3-10724
Species: Hu
Applications: WB

Publications for FAM131B Antibody (NBP3-10724) (0)

There are no publications for FAM131B Antibody (NBP3-10724).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM131B Antibody (NBP3-10724) (0)

There are no reviews for FAM131B Antibody (NBP3-10724). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM131B Antibody (NBP3-10724) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM131B Products

Bioinformatics Tool for FAM131B Antibody (NBP3-10724)

Discover related pathways, diseases and genes to FAM131B Antibody (NBP3-10724). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM131B Antibody (NBP3-10724)

Discover more about diseases related to FAM131B Antibody (NBP3-10724).

PTMs for FAM131B Antibody (NBP3-10724)

Learn more about PTMs related to FAM131B Antibody (NBP3-10724).

Blogs on FAM131B

There are no specific blogs for FAM131B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM131B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM131B