FAM130A1 Antibody

Images

 
Western Blot: FAM130A1 Antibody [NBP2-58064] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: FAM130A1 Antibody [NBP2-58064] - Staining of human cell line SiHa shows localization to nuclear speckles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM130A1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GVCILEEPLAVPEELCPGLTAPILIQAQLPPGSSVLCFTENSDHPTASTVNSPSYLNSGPLVYYQVEQRPVLGVKG
Specificity
Specificity of human FAM130A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CSRNP2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM130A1 Recombinant Protein Antigen (NBP2-58064PEP)

Reactivity Notes

Mouse 88%, Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FAM130A1 Antibody

  • C12ORF2
  • C12orf22
  • CSRNP-2
  • cysteine/serine-rich nuclear protein 2
  • cysteine-serine-rich nuclear protein 2
  • FAM130A1
  • family with sequence similarity 130, member A1
  • FLJ25576
  • Protein FAM130A1
  • TAIP12
  • TAIP-12chromosome 12 open reading frame 22
  • TGF-beta-induced apoptosis protein 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84725
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
H00004692-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
H00007337-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-84320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58064
Species: Hu
Applications: WB, ICC/IF

Publications for FAM130A1 Antibody (NBP2-58064) (0)

There are no publications for FAM130A1 Antibody (NBP2-58064).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM130A1 Antibody (NBP2-58064) (0)

There are no reviews for FAM130A1 Antibody (NBP2-58064). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM130A1 Antibody (NBP2-58064) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM130A1 Products

Bioinformatics Tool for FAM130A1 Antibody (NBP2-58064)

Discover related pathways, diseases and genes to FAM130A1 Antibody (NBP2-58064). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM130A1

There are no specific blogs for FAM130A1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM130A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSRNP2