Factor IX Antibody (2C9)

Images

 
Western Blot: Factor IX Antibody (2C9) [H00002158-M01] - Analysis of F9 expression in transfected 293T cell line by F9 monoclonal antibody (M01), clone 2C9.Lane 1: F9 transfected lysate(51.8 KDa).Lane 2: Non-transfected ...read more
Western Blot: Factor IX Antibody (2C9) [H00002158-M01] - Analysis of F9 over-expressed 293 cell line, cotransfected with F9 Validated Chimera RNAi ( Cat # H00002158-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Immunoprecipitation: Factor IX Antibody (2C9) [H00002158-M01] - Analysis of F9 transfected lysate using anti-F9 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with F9 MaxPab rabbit polyclonal ...read more
ELISA: Factor IX Antibody (2C9) [H00002158-M01] - Detection limit for recombinant GST tagged F9 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP, RNAi
Clone
2C9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Factor IX Antibody (2C9) Summary

Immunogen
F9 (NP_000124, 96 a.a. - 190 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLT
Specificity
F9 - coagulation factor IX (plasma thromboplastic component, Christmas disease, hemophilia B)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
F9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
  • RNA Inhibition
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Factor IX Antibody (2C9)

  • Christmas Factor
  • Coagulation Factor IX
  • EC 3.4.21
  • EC 3.4.21.22
  • F9
  • factor 9
  • FIX
  • HEMB
  • MGC129641
  • MGC129642
  • P19
  • Plasma Thromboplastic Component
  • Plasma thromboplastin component
  • PTC
  • THPH8

Background

This gene encodes vitamin K-dependent coagulation factor IX that circulates in the blood as an inactive zymogen. This factor is converted to an active form by factor XIa, which excises the activation peptide and thus generates a heavy chain and a light chain held together by one or more disulfide bonds. The role of this activated factor IX in the blood coagulation cascade is to activate factor X to its active form through interactions with Ca+2 ions, membrane phospholipids, and factor VIII. Alterations of this gene, including point mutations, insertions and deletions, cause factor IX deficiency, which is a recessive X-linked disorder, also called hemophilia B or Christmas disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-57016
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb
Applications: WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1916
Species: Hu
Applications: WB, IHC, ICC
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP2-34031
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Factor IX Antibody (H00002158-M01) (0)

There are no publications for Factor IX Antibody (H00002158-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Factor IX Antibody (H00002158-M01) (0)

There are no reviews for Factor IX Antibody (H00002158-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Factor IX Antibody (H00002158-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Factor IX Products

Bioinformatics Tool for Factor IX Antibody (H00002158-M01)

Discover related pathways, diseases and genes to Factor IX Antibody (H00002158-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Factor IX Antibody (H00002158-M01)

Discover more about diseases related to Factor IX Antibody (H00002158-M01).
 

Pathways for Factor IX Antibody (H00002158-M01)

View related products by pathway.

PTMs for Factor IX Antibody (H00002158-M01)

Learn more about PTMs related to Factor IX Antibody (H00002158-M01).

Blogs on Factor IX

There are no specific blogs for Factor IX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Factor IX Antibody (2C9) and receive a gift card or discount.

Bioinformatics

Gene Symbol F9
Entrez
OMIM
Uniprot