Exostosin-like 2/EXTL2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Exostosin-like 2/EXTL2 Antibody [NBP2-56467] - Staining of human cell line SH-SY5Y shows localization to nucleus & cytosol.

• Reactivity: Hu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Exostosin-like 2/EXTL2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEM
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EXTL2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Exostosin-like 2/EXTL2 Recombinant Protein Antigen (NBP2-56467PEP)

Reactivity Notes

Mouse 89%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Exostosin-like 2/EXTL2 Antibody - BSA Free

• Alpha-1,4-N-acetylhexosaminyltransferase EXTL2
• alpha-1,4-N-acteylhexosaminyltransferase
• Alpha-GalNAcT EXTL2
• EC 2.4.1.223
• exostoses (multiple)-like 2
• Exostosin like 2
• Exostosin-like 2
• EXTL2
• EXTR2
• EXT-related protein 2
• Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase
• processed exostosin-like 2

Background

Exostosin-like 2, or EXTL2 can be found in the extracellular region of the endoplasmic reticulum and is integral to the membrane. Belonging to the glycosyltransferase 47 family, EXTL2 encodes 4-N-acetylhexosamynyltransferase and transfers N-acetylglucosamine to the glycosaminoglycan (GAG) protein linkage region. More specifically, EXTL2 is critical for the synthesis of heparin/heparan sulfate, and the lack of EXTL2 can cause GAG overproduction. Biological processes associated with EXTL2 include the N-acetylglucosamine metabolic process, heparan sulfate proteoglycan biosynthetic process and UDP-N-acetylgalactosamine metabolic process. Known diseases for EXTL2 include Exostosis and hereditary multiple exostoses.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EXTL2