Exostosin-like 2/EXTL2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Exostosin-like 2/EXTL2 Antibody [NBP2-56467] - Staining of human cell line SH-SY5Y shows localization to nucleus & cytosol.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Exostosin-like 2/EXTL2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEM
Specificity
Specificity of human Exostosin-like 2/EXTL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EXTL2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Exostosin-like 2/EXTL2 Recombinant Protein Antigen (NBP2-56467PEP)

Reactivity Notes

Mouse 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Exostosin-like 2/EXTL2 Antibody

  • Alpha-1,4-N-acetylhexosaminyltransferase EXTL2
  • alpha-1,4-N-acteylhexosaminyltransferase
  • Alpha-GalNAcT EXTL2
  • EC 2.4.1.223
  • exostoses (multiple)-like 2
  • Exostosin like 2
  • Exostosin-like 2
  • EXTL2
  • EXTR2
  • EXT-related protein 2
  • Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase
  • processed exostosin-like 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91875
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-58297
Species: Hu
Applications: WB, IHC, IHC-P
AF2635
Species: Hu
Applications: WB
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4214
Species: Mu
Applications: WB, IP
NBP2-31985
Species: Hu, Eq
Applications: ICC/IF, IHC, IHC-P
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-91982
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33208
Species: Hu
Applications: WB, ICC/IF
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-84971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Exostosin-like 2/EXTL2 Antibody (NBP2-56467) (0)

There are no publications for Exostosin-like 2/EXTL2 Antibody (NBP2-56467).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Exostosin-like 2/EXTL2 Antibody (NBP2-56467) (0)

There are no reviews for Exostosin-like 2/EXTL2 Antibody (NBP2-56467). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Exostosin-like 2/EXTL2 Antibody (NBP2-56467) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Exostosin-like 2/EXTL2 Products

Bioinformatics Tool for Exostosin-like 2/EXTL2 Antibody (NBP2-56467)

Discover related pathways, diseases and genes to Exostosin-like 2/EXTL2 Antibody (NBP2-56467). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Exostosin-like 2/EXTL2 Antibody (NBP2-56467)

Discover more about diseases related to Exostosin-like 2/EXTL2 Antibody (NBP2-56467).
 

Pathways for Exostosin-like 2/EXTL2 Antibody (NBP2-56467)

View related products by pathway.

PTMs for Exostosin-like 2/EXTL2 Antibody (NBP2-56467)

Learn more about PTMs related to Exostosin-like 2/EXTL2 Antibody (NBP2-56467).
 

Research Areas for Exostosin-like 2/EXTL2 Antibody (NBP2-56467)

Find related products by research area.

Blogs on Exostosin-like 2/EXTL2

There are no specific blogs for Exostosin-like 2/EXTL2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Exostosin-like 2/EXTL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EXTL2