Eukaryotic translation initiation factor 5B Recombinant Protein Antigen

Images

 
There are currently no images for Eukaryotic translation initiation factor 5B Protein (NBP1-85120PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Eukaryotic translation initiation factor 5B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EIF5B.

Source: E. coli

Amino Acid Sequence: QEMADSLGVRIFSAEIIYHLFDAFTKYRQDYKKQKQEEFKHIAVFPCKIKILPQYIFNSRDPIVMGVTVEAGQVKQGTPMCVPSK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EIF5B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85120.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Eukaryotic translation initiation factor 5B Recombinant Protein Antigen

  • DKFZp434I036
  • eukaryotic translation initiation factor 5B
  • FLJ10524
  • IF2Translation initiation factor IF-2
  • KIAA0741eIF-5B
  • translation initiation factor IF2

Background

Accurate initiation of translation in eukaryotes is complex and requires many factors, some of which are composed of multiple subunits. The process is simpler in prokaryotes which have only three initiation factors (IF1, IF2, IF3). Two of these factors are conserved in eukaryotes: the homolog of IF1 is eIF1A and the homolog of IF2 is eIF5B. This gene encodes eIF5B. Factors eIF1A and eIF5B interact on the ribosome along with other initiation factors and GTP to position the initiation methionine tRNA on the start codon of the mRNA so that translation initiates accurately. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92880
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-36751
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP2-00702
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-85808
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-2736
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-16311
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-95177
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-268
Species: Hu, Po
Applications: IP, WB
NBP1-31528
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-24529
Species: Ca, Ch, Hu, Mu, Pm
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-24632
Species: Ca, Ch, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
MAB3228
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-01232
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for Eukaryotic translation initiation factor 5B Protein (NBP1-85120PEP) (0)

There are no publications for Eukaryotic translation initiation factor 5B Protein (NBP1-85120PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Eukaryotic translation initiation factor 5B Protein (NBP1-85120PEP) (0)

There are no reviews for Eukaryotic translation initiation factor 5B Protein (NBP1-85120PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Eukaryotic translation initiation factor 5B Protein (NBP1-85120PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Eukaryotic translation initiation factor 5B Products

Blogs on Eukaryotic translation initiation factor 5B

There are no specific blogs for Eukaryotic translation initiation factor 5B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Eukaryotic translation initiation factor 5B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF5B