Recombinant Human Eukaryotic translation initiation factor 5B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Eukaryotic translation initiation factor 5B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1121-1218 of Human EIF5B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QGTPMCVPSKNFVDIGIVTSIEINHKQVDVAKKGQEVCVKIEPIPGESPKMFGRHFEATDILVSKISRQSIDALKDWFRDEMQKSDWQLIVELKKVFE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
EIF5B
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Eukaryotic translation initiation factor 5B Protein

  • DKFZp434I036
  • eukaryotic translation initiation factor 5B
  • FLJ10524
  • IF2Translation initiation factor IF-2
  • KIAA0741eIF-5B
  • translation initiation factor IF2

Background

EIF5B - eukaryotic translation initiation factor 5B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90069
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-36751
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-00702
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16289
Species: Hu
Applications: WB
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-86184
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-81609
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
NBP2-24632
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01232
Species: Hu
Applications: WB, IHC, IHC-P
H00009669-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Eukaryotic translation initiation factor 5B Partial Recombinant Protein (H00009669-Q01) (0)

There are no publications for Eukaryotic translation initiation factor 5B Partial Recombinant Protein (H00009669-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Eukaryotic translation initiation factor 5B Partial Recombinant Protein (H00009669-Q01) (0)

There are no reviews for Eukaryotic translation initiation factor 5B Partial Recombinant Protein (H00009669-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Eukaryotic translation initiation factor 5B Partial Recombinant Protein (H00009669-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Eukaryotic translation initiation factor 5B Products

Bioinformatics Tool for Eukaryotic translation initiation factor 5B Partial Recombinant Protein (H00009669-Q01)

Discover related pathways, diseases and genes to Eukaryotic translation initiation factor 5B Partial Recombinant Protein (H00009669-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Eukaryotic translation initiation factor 5B Partial Recombinant Protein (H00009669-Q01)

Discover more about diseases related to Eukaryotic translation initiation factor 5B Partial Recombinant Protein (H00009669-Q01).
 

Pathways for Eukaryotic translation initiation factor 5B Partial Recombinant Protein (H00009669-Q01)

View related products by pathway.

PTMs for Eukaryotic translation initiation factor 5B Partial Recombinant Protein (H00009669-Q01)

Learn more about PTMs related to Eukaryotic translation initiation factor 5B Partial Recombinant Protein (H00009669-Q01).

Blogs on Eukaryotic translation initiation factor 5B

There are no specific blogs for Eukaryotic translation initiation factor 5B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Eukaryotic translation initiation factor 5B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF5B