Recombinant Human ethanolamine kinase Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ethanolamine kinase Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-169 of Human ETNK1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFSLSSLTLCKGKTTRCFGLTGCRGSRLLLSFF

Protein/Peptide Type
Recombinant Protein
Gene
ETNK1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ethanolamine kinase Protein

  • EC 2.7.1.82
  • EKI 1
  • EKI
  • EKI1putative protein product of Nbla10396
  • ethanolamine kinase 1
  • Nbla10396

Background

This gene encodes an ethanolamine kinase, which functions in the first committed step of the phosphatidylethanolamine synthesis pathway. This cytosolic enzyme is specific for ethanolamine and exhibits negligible kinase activity on choline. Alternative splicing results in multiple transcript variants encoding distinct isoforms. ETNK1( AAH06111, 1 a.a. - 170 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1585
Species: Hu
Applications: WB, IP
NBP2-53421
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007290-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-84724
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-98506
Species: Mu
Applications: WB
NBP2-20398
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
H00085465-A01
Species: Hu
Applications: WB, ELISA
NBP2-37371
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
AF432
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
AF5286
Species: Hu
Applications: WB
AF3629
Species: Hu, Mu, Rt
Applications: WB, Neut
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NBP1-88825
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85861
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89611
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45677
Species: Hu, Mk
Applications: WB, IHC
H00055500-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ethanolamine kinase Recombinant Protein (H00055500-P01) (0)

There are no publications for ethanolamine kinase Recombinant Protein (H00055500-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ethanolamine kinase Recombinant Protein (H00055500-P01) (0)

There are no reviews for ethanolamine kinase Recombinant Protein (H00055500-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ethanolamine kinase Recombinant Protein (H00055500-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ethanolamine kinase Products

Bioinformatics Tool for ethanolamine kinase Recombinant Protein (H00055500-P01)

Discover related pathways, diseases and genes to ethanolamine kinase Recombinant Protein (H00055500-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ethanolamine kinase Recombinant Protein (H00055500-P01)

Discover more about diseases related to ethanolamine kinase Recombinant Protein (H00055500-P01).

Blogs on ethanolamine kinase

There are no specific blogs for ethanolamine kinase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ethanolamine kinase Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ETNK1