Recombinant Human ESCO2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ESCO2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 601 of Human ESCO2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAALTPRKRKQDSLKCDSLLHFTENLFPSPNKKHCFYQNSDKNEENLHCSQQEHFVLSALKTTEINRLPSANQGSPFKSALSTVSFYNQNKWYLNPLERKLIKESRSTCLKTNDEDKSFPIVTEKMQGKPVCSKKNNKKPQKSLTAKYQPKYRHIKPVSRNSRNSKQNRVIYKPIVEKENNCHSAENNSNAPRVLSQKIKPQVTLQGGAAFFVRKKSSLRKSSLENEPSLGRTQKSKSEVIEDSDVETVSEKKTFATRQVPKCLVLEEKLKIGLLSASSKNKEKLIKDSSDDRVSSKEHKVDKNEAFSSEDSLGENKTISPKSTVYPIFSASSVNSKRSLGEEQFSVGSVNFMKQTNIQKNTNTRDTSKKTKDQLIIDAGQKHFGATVCKSCGMIYTASNPEDEMQHVQHHHRFLEGIKYVGWKKERVVAEFWDGKIVLVLPHDPSFAIKKVEDVQELVDNELGFQQVVPKCPNKIKTFLFISDEKRVVGCLIAEPIKQAFRVLSEPIGPESPSSTECPRAWQCSDVPEPAVCGISRIWVFRLKRRKRIARRLVDTLRNCFMFGCFLSTDEIAFSDPTPDGKLFATKYCNTPNFLVYNFNS

Protein/Peptide Type
Recombinant Protein
Gene
ESCO2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ESCO2 Protein

  • 2410004I17Rik
  • EC 2.3.1.-
  • ECO1 homolog 2
  • EFO2
  • establishment of cohesion 1 homolog 2 (S. cerevisiae)
  • Establishment of cohesion 1 homolog 2
  • N-acetyltransferase ESCO2
  • RBS
  • Roberts syndrome

Background

This gene encodes a protein that may have acetyltransferase activity and may be required for the establishment of sister chromatid cohesion during the S phase of mitosis. Mutations in this gene have been associated with Roberts syndrome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NBP1-87957
Species: Hu
Applications: IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-93575
Species: NA, Vi
Applications: WB, IHC
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-207
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-16453
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-83917
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85110
Species: Hu
Applications: ICC/IF, IHC, IF

Publications for ESCO2 Recombinant Protein (H00157570-P01) (0)

There are no publications for ESCO2 Recombinant Protein (H00157570-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ESCO2 Recombinant Protein (H00157570-P01) (0)

There are no reviews for ESCO2 Recombinant Protein (H00157570-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ESCO2 Recombinant Protein (H00157570-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ESCO2 Products

Bioinformatics Tool for ESCO2 Recombinant Protein (H00157570-P01)

Discover related pathways, diseases and genes to ESCO2 Recombinant Protein (H00157570-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ESCO2 Recombinant Protein (H00157570-P01)

Discover more about diseases related to ESCO2 Recombinant Protein (H00157570-P01).
 

Pathways for ESCO2 Recombinant Protein (H00157570-P01)

View related products by pathway.

PTMs for ESCO2 Recombinant Protein (H00157570-P01)

Learn more about PTMs related to ESCO2 Recombinant Protein (H00157570-P01).
 

Research Areas for ESCO2 Recombinant Protein (H00157570-P01)

Find related products by research area.

Blogs on ESCO2

There are no specific blogs for ESCO2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ESCO2 Antibody
NB100-87021

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ESCO2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ESCO2