ErbB3/Her3 Recombinant Protein Antigen

Images

 
There are currently no images for ErbB3/Her3 Recombinant Protein Antigen (NBP3-24822PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ErbB3/Her3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ErbB3/Her3

Source: E.coli

Amino Acid Sequence: PIMPTAGTTPDEDYEYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATDSAFDNPDYWHSRLFPKANAQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
ERBB3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24822It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ErbB3/Her3 Recombinant Protein Antigen

  • c-erbB3
  • EC 2.7.10
  • EC 2.7.10.1
  • ErbB3
  • ErbB-3
  • erbB3-S
  • HER3
  • HER3c-erbB-3
  • LCCS2
  • lethal congenital contracture syndrome 2
  • MDA-BF-1
  • MGC88033
  • p180-ErbB3
  • p45-sErbB3
  • p85-sErbB3
  • Proto-oncogene-like protein c-ErbB-3
  • receptor tyrosine-protein kinase erbB-3
  • Tyrosine kinase-type cell surface receptor HER3
  • v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)

Background

The ErbB3 gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. ErbB3 is a membrane-bound protein which has a neuregulin binding domain but not an active kinase domain. It can therefore bind this ligand but cannot convey a signal into the cell via protein phosphorylation. However it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers including prostate, bladder and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported but they have not been thoroughly characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
1129-ER
Species: Hu
Applications: BA
MAB1131
Species: Hu
Applications: ICC, IHC, WB
236-EG
Species: Hu
Applications: BA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB6860
Species: Hu
Applications: IP, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
AF1905
Species: Mu
Applications: WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF262
Species: Hu
Applications: ICC, IHC, Neut, WB
NBP3-24822PEP
Species: Hu
Applications: AC

Publications for ErbB3/Her3 Recombinant Protein Antigen (NBP3-24822PEP) (0)

There are no publications for ErbB3/Her3 Recombinant Protein Antigen (NBP3-24822PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ErbB3/Her3 Recombinant Protein Antigen (NBP3-24822PEP) (0)

There are no reviews for ErbB3/Her3 Recombinant Protein Antigen (NBP3-24822PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ErbB3/Her3 Recombinant Protein Antigen (NBP3-24822PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ErbB3/Her3 Products

Research Areas for ErbB3/Her3 Recombinant Protein Antigen (NBP3-24822PEP)

Find related products by research area.

Blogs on ErbB3/Her3.

Hypoxia-Dependent CAR Stabilizing Construct in T cells Improves Solid Tumor Targeting and Efficacy
By Victoria Osinski, PhDDespite advances in the development of cancer immunotherapies, those specifically targeting tumors still remains limited. Currently, there is great interest in utilizing chimeric antigen rece...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ErbB3/Her3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ERBB3