Epithelial Stromal Interaction 1 Antibody - BSA Free

Western Blot: epithelial stromal interaction 1 Antibody [NBP1-69247] - This Anti-EPSTI1 antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.

Product Discontinued

Epithelial Stromal Interaction 1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to EPSTI1(epithelial stromal interaction 1 (breast)) The peptide sequence was selected from the N terminal of Epithelial Stromal Interaction 1. Peptide sequence RRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPSTI1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 47 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Epithelial Stromal Interaction 1 Antibody - BSA Free

• BRESI1
• EC 3.1.4.16
• EC 3.6.3.6
• epithelial stromal interaction 1 (breast)
• epithelial-stromal interaction protein 1
• MGC29634

Background

Epithelial Stromal Interaction 1 was up-regulated in breast carcinomas. The exact function of Epithelial Stromal Interaction 1 is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EPSTI1
• Uniprot:
  • Q96J88(Human)