Epithelial Stromal Interaction 1 Antibody


Western Blot: epithelial stromal interaction 1 Antibody [NBP1-69247] - This Anti-EPSTI1 antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Epithelial Stromal Interaction 1 Antibody Summary

Synthetic peptides corresponding to EPSTI1(epithelial stromal interaction 1 (breast)) The peptide sequence was selected from the N terminal of Epithelial Stromal Interaction 1. Peptide sequence RRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against EPSTI1 and was validated on Western blot.
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Epithelial Stromal Interaction 1 Antibody

  • BRESI1
  • EC
  • EC
  • epithelial stromal interaction 1 (breast)
  • epithelial-stromal interaction protein 1
  • MGC29634


Epithelial Stromal Interaction 1 was up-regulated in breast carcinomas. The exact function of Epithelial Stromal Interaction 1 is not known.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, ChHa, Eq, Pm, Rb
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
Species: Hu
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, Simple Western, IHC-P
Species: Mu
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: IHC
Species: Hu
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: IHC, IHC-P

Publications for Epithelial Stromal Interaction 1 Antibody (NBP1-69247) (0)

There are no publications for Epithelial Stromal Interaction 1 Antibody (NBP1-69247).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Epithelial Stromal Interaction 1 Antibody (NBP1-69247) (0)

There are no reviews for Epithelial Stromal Interaction 1 Antibody (NBP1-69247). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Epithelial Stromal Interaction 1 Antibody (NBP1-69247) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Epithelial Stromal Interaction 1 Products

Bioinformatics Tool for Epithelial Stromal Interaction 1 Antibody (NBP1-69247)

Discover related pathways, diseases and genes to Epithelial Stromal Interaction 1 Antibody (NBP1-69247). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Epithelial Stromal Interaction 1 Antibody (NBP1-69247)

Discover more about diseases related to Epithelial Stromal Interaction 1 Antibody (NBP1-69247).

Pathways for Epithelial Stromal Interaction 1 Antibody (NBP1-69247)

View related products by pathway.

Blogs on Epithelial Stromal Interaction 1

There are no specific blogs for Epithelial Stromal Interaction 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Epithelial Stromal Interaction 1 Antibody and receive a gift card or discount.


Gene Symbol EPSTI1