Epimorphin/Syntaxin 2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Epimorphin/Syntaxin 2. Source: E. coli Amino Acid Sequence: DRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNTIDKITQYVEEVKK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
STX2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55283. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Epimorphin/Syntaxin 2 Recombinant Protein Antigen
Background
Syntaxin 2, also known as epimorphin, is a 35 kDa type II integral membrane that belongs to the t SNARE family, a group of proteins involved in protein transport. Syntaxin 2 was first identified as a factor that promotes branching morphogenesis in mammary epithelial cells. Studies using pancreatic exocrine acinar cells, in which the exocytic pathways are well defined, show primary localization of syntaxin 2 to the apical plasma membrane. Homologs of syntaxin 2 have been identified in various eukaryotes ranging from yeast to human. Neuronal syntaxin is a component of a 20S complex implicated in vesicle docking and fusion, which involves its interaction with syntaxin through a ATP dependent reaction modulated by synaptotagmin, SNAP 25, alpha SNAP, and NSF.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
Publications for Epimorphin/Syntaxin 2 Recombinant Protein Antigen (NBP2-55283PEP) (0)
There are no publications for Epimorphin/Syntaxin 2 Recombinant Protein Antigen (NBP2-55283PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Epimorphin/Syntaxin 2 Recombinant Protein Antigen (NBP2-55283PEP) (0)
There are no reviews for Epimorphin/Syntaxin 2 Recombinant Protein Antigen (NBP2-55283PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Epimorphin/Syntaxin 2 Recombinant Protein Antigen (NBP2-55283PEP) (0)
Additional Epimorphin/Syntaxin 2 Products
Research Areas for Epimorphin/Syntaxin 2 Recombinant Protein Antigen (NBP2-55283PEP)
Find related products by research area.
|
Blogs on Epimorphin/Syntaxin 2