Epimorphin/Syntaxin 2 Recombinant Protein Antigen

Images

 
There are currently no images for Epimorphin/Syntaxin 2 Recombinant Protein Antigen (NBP2-55283PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Epimorphin/Syntaxin 2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Epimorphin/Syntaxin 2.

Source: E. coli

Amino Acid Sequence: DRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNTIDKITQYVEEVKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STX2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55283.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Epimorphin/Syntaxin 2 Recombinant Protein Antigen

  • EPIMepimorphin
  • Epimorphin
  • EPM
  • STX2
  • STX2AMGC51014
  • STX2Bsyntaxin-2
  • STX2CEpimorphin
  • Syntaxin 2

Background

Syntaxin 2, also known as epimorphin, is a 35 kDa type II integral membrane that belongs to the t SNARE family, a group of proteins involved in protein transport. Syntaxin 2 was first identified as a factor that promotes branching morphogenesis in mammary epithelial cells. Studies using pancreatic exocrine acinar cells, in which the exocytic pathways are well defined, show primary localization of syntaxin 2 to the apical plasma membrane. Homologs of syntaxin 2 have been identified in various eukaryotes ranging from yeast to human. Neuronal syntaxin is a component of a 20S complex implicated in vesicle docking and fusion, which involves its interaction with syntaxin through a ATP dependent reaction modulated by synaptotagmin, SNAP 25, alpha SNAP, and NSF.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-15706
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF6590
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
AF4999
Species: Mu
Applications: Simple Western, WB
AF6306
Species: Hu
Applications: ICC, WB
DFN00
Species: Hu
Applications: ELISA
NBP1-87374
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-38713
Species: Hu
Applications: IHC,  IHC-P
MAB6848
Species: Hu, Mu, Rt
Applications: WB
NBP3-13179
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P
NBP1-33714
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-86984
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB4987
Species: Hu, Mu, Rt
Applications: WB
H00001392-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NLS3775
Species: Hu, Pm
Applications: ICC/IF, IHC,  IHC-P

Publications for Epimorphin/Syntaxin 2 Recombinant Protein Antigen (NBP2-55283PEP) (0)

There are no publications for Epimorphin/Syntaxin 2 Recombinant Protein Antigen (NBP2-55283PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Epimorphin/Syntaxin 2 Recombinant Protein Antigen (NBP2-55283PEP) (0)

There are no reviews for Epimorphin/Syntaxin 2 Recombinant Protein Antigen (NBP2-55283PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Epimorphin/Syntaxin 2 Recombinant Protein Antigen (NBP2-55283PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Epimorphin/Syntaxin 2 Products

Research Areas for Epimorphin/Syntaxin 2 Recombinant Protein Antigen (NBP2-55283PEP)

Find related products by research area.

Blogs on Epimorphin/Syntaxin 2

There are no specific blogs for Epimorphin/Syntaxin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Epimorphin/Syntaxin 2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol STX2