Epimorphin/Syntaxin 2 Antibody

Images

 
Western Blot: Epimorphin/Syntaxin 2 Antibody [H00002054-D01P] - Analysis of STX2 expression in human liver.
Western Blot: Epimorphin/Syntaxin 2 Antibody [H00002054-D01P] - Analysis of STX2 expression in HepG2.
Western Blot: Epimorphin/Syntaxin 2 Antibody [H00002054-D01P] - Analysis of STX2 expression in transfected 293T cell line by STX2 polyclonal antibody.Lane 1: STX2 transfected lysate(33.30 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Epimorphin/Syntaxin 2 Antibody Summary

Immunogen
STX2 (NP_001971.2, 1 a.a. - 287 a.a.) full-length human protein. MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKLMFIIICVIVLLVILGIILATTLS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STX2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Epimorphin/Syntaxin 2 Antibody

  • EPIMepimorphin
  • Epimorphin
  • EPM
  • STX2
  • STX2AMGC51014
  • STX2Bsyntaxin-2
  • STX2CEpimorphin
  • Syntaxin 2

Background

The product of this gene belongs to the syntaxin/epimorphin family of proteins. The syntaxins are a large protein family implicated in the targeting and fusion of intracellular transport vesicles. The product of this gene regulates epithelial-mesenchymal interactions and epithelial cell morphogenesis and activation. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
AF6590
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF4779
Species: Hu
Applications: WB, IHC
NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-38713
Species: Hu
Applications: WB, IHC, IHC-P
MAB6848
Species: Hu, Mu, Rt
Applications: WB
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15131
Species: Hu
Applications: WB
NBP2-02576
Species: Hu, Rt, Mk
Applications: WB, Flow, ICC/IF
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
H00002054-D01P
Species: Hu
Applications: WB

Publications for Epimorphin/Syntaxin 2 Antibody (H00002054-D01P) (0)

There are no publications for Epimorphin/Syntaxin 2 Antibody (H00002054-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Epimorphin/Syntaxin 2 Antibody (H00002054-D01P) (0)

There are no reviews for Epimorphin/Syntaxin 2 Antibody (H00002054-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Epimorphin/Syntaxin 2 Antibody (H00002054-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Epimorphin/Syntaxin 2 Products

Bioinformatics Tool for Epimorphin/Syntaxin 2 Antibody (H00002054-D01P)

Discover related pathways, diseases and genes to Epimorphin/Syntaxin 2 Antibody (H00002054-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Epimorphin/Syntaxin 2 Antibody (H00002054-D01P)

Discover more about diseases related to Epimorphin/Syntaxin 2 Antibody (H00002054-D01P).
 

Pathways for Epimorphin/Syntaxin 2 Antibody (H00002054-D01P)

View related products by pathway.

PTMs for Epimorphin/Syntaxin 2 Antibody (H00002054-D01P)

Learn more about PTMs related to Epimorphin/Syntaxin 2 Antibody (H00002054-D01P).

Blogs on Epimorphin/Syntaxin 2

There are no specific blogs for Epimorphin/Syntaxin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Epimorphin/Syntaxin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STX2
Entrez
Uniprot