enkurin Recombinant Protein Antigen

Images

 
There are currently no images for enkurin Protein (NBP2-34037PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

enkurin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ENKUR.

Source: E.coli

Amino Acid Sequence: KKAQEDYDRYIQENLKKAAMKRLSDEEREAVLQGLKKNWEEVHKEFQSLSVFIDSIPKKIRKQRLEEEMKQLEHDIGIIEKHKIIYIAN

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ENKUR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-34037.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for enkurin Recombinant Protein Antigen

  • C10orf63DKFZp781F21103
  • chromosome 10 open reading frame 63
  • enkurin
  • enkurin, TRPC channel interacting protein
  • MGC26778

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12919
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP, MiAr
NBP1-77262
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
NB100-98844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-15669
Species: Hu, Mu, Rt
Applications: WB, IHC
AF2364
Species: Hu
Applications: WB, IHC
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-67058
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34136
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-80537
Species: Mu
Applications: WB, IHC, IHC-P
NBP2-67504
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF3320
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-20989
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-91266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-536
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KO
NB100-1087
Species: Hu
Applications: WB, PEP-ELISA
NBP2-34037PEP
Species: Hu
Applications: AC

Publications for enkurin Protein (NBP2-34037PEP) (0)

There are no publications for enkurin Protein (NBP2-34037PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for enkurin Protein (NBP2-34037PEP) (0)

There are no reviews for enkurin Protein (NBP2-34037PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for enkurin Protein (NBP2-34037PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional enkurin Products

Bioinformatics Tool for enkurin Protein (NBP2-34037PEP)

Discover related pathways, diseases and genes to enkurin Protein (NBP2-34037PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on enkurin

There are no specific blogs for enkurin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Rac1 Antibody
NB100-91266

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our enkurin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ENKUR