Recombinant Human Emerin Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Emerin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human EMD partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLSPPSSSAASSYSFSDLNSTRGDADMYDLPKKEDALLYQSKGYNDDYYEESYFTTRTYGEPES

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
EMD

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Emerin Protein

  • emerin
  • Emery-Dreifuss muscular dystrophy
  • LEM domain containing 5
  • STAEDMDLEMD5

Background

EMD - emerin (Emery-Dreifuss muscular dystrophy)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-85550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008815-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-77242
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-86665
Species: Hu
Applications: WB, IHC, IHC-P
H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02211
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBL1-12154
Species: Hu
NBP2-13968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-59944
Species: Hu
Applications: WB, ICC/IF
H00002010-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Emerin Partial Recombinant Protein (H00002010-Q01) (0)

There are no publications for Emerin Partial Recombinant Protein (H00002010-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Emerin Partial Recombinant Protein (H00002010-Q01) (0)

There are no reviews for Emerin Partial Recombinant Protein (H00002010-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Emerin Partial Recombinant Protein (H00002010-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Emerin Products

Bioinformatics Tool for Emerin Partial Recombinant Protein (H00002010-Q01)

Discover related pathways, diseases and genes to Emerin Partial Recombinant Protein (H00002010-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Emerin Partial Recombinant Protein (H00002010-Q01)

Discover more about diseases related to Emerin Partial Recombinant Protein (H00002010-Q01).
 

Pathways for Emerin Partial Recombinant Protein (H00002010-Q01)

View related products by pathway.

PTMs for Emerin Partial Recombinant Protein (H00002010-Q01)

Learn more about PTMs related to Emerin Partial Recombinant Protein (H00002010-Q01).

Blogs on Emerin

There are no specific blogs for Emerin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Emerin Antibody
NBP1-87692

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Emerin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EMD