![Western Blot: EME2 Antibody [NBP2-83003] - Host: Rabbit. Target Name: EME2. Sample Type: MCF7 Whole cell lysates. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/EME2-Antibody-Western-Blot-NBP2-83003-img0001.jpg "Western Blot: EME2 Antibody [NBP2-83003] - Host: Rabbit. Target Name: EME2. Sample Type: MCF7 Whole cell lysates. Antibody Dilution: 1.0ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit EME2 Antibody - BSA Free (NBP2-83003) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human EME2. Peptide sequence: TTARPHLAVIGLDAYLWSRQHVSRGTQQPESPKVAGAEVAVSWPEVEEVR The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EME2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunohistochemistry TSH beta Antibody (512908) [Unconjugated]](https://images.novusbio.com/images2/TSH_beta_MAB57941_Immunohistochemistry_10164.jpg)
![Western Blot TSH beta Antibody (512908) [Unconjugated]](https://images.novusbio.com/images2/TSH_beta_MAB57941_Western_Blot_9414.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for EME2 Antibody (NBP2-83003)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EME2 |
![Western Blot: EME2 Antibody [NBP2-83003] - Host: Rabbit. Target: EME2. Positive control (+): HepG2 (HG). Negative control (-): Human liver (LI). Antibody concentration: 3ug/ml](http://images.novusbio.com/fullsize/EME2-Antibody-Western-Blot-NBP2-83003-img0002.jpg "Western Blot: EME2 Antibody [NBP2-83003] - Host: Rabbit. Target: EME2. Positive control (+): HepG2 (HG). Negative control (-): Human liver (LI). Antibody concentration: 3ug/ml")
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
