Recombinant Human ELF3/ESE-1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ELF3/ESE-1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human ELF3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ELF3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ELF3/ESE-1 Protein

  • E74-like factor 3 (ets domain transcription factor, epithelial-specific )
  • E74-like factor 3
  • ELF3
  • Epithelial-restricted with serine box
  • epithelial-specific)
  • Epithelium-restricted Ets protein ESX
  • Epithelium-specific Ets transcription factor 1
  • EPR1
  • EPR-1
  • ERT
  • ESX
  • ets domain transcription factor, serine box (epithelial-specific)
  • ETS-related transcription factor Elf-3
  • JEN
  • serine box

Background

ELF3 - E74-like factor 3 (ets domain transcription factor, epithelial-specific )

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6146
Species: Hu
Applications: ICC
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-69295
Species: Hu
Applications: WB, ICC/IF, IHC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP

Publications for ELF3/ESE-1 Partial Recombinant Protein (H00001999-Q01) (0)

There are no publications for ELF3/ESE-1 Partial Recombinant Protein (H00001999-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELF3/ESE-1 Partial Recombinant Protein (H00001999-Q01) (0)

There are no reviews for ELF3/ESE-1 Partial Recombinant Protein (H00001999-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELF3/ESE-1 Partial Recombinant Protein (H00001999-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ELF3/ESE-1 Products

Bioinformatics Tool for ELF3/ESE-1 Partial Recombinant Protein (H00001999-Q01)

Discover related pathways, diseases and genes to ELF3/ESE-1 Partial Recombinant Protein (H00001999-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELF3/ESE-1 Partial Recombinant Protein (H00001999-Q01)

Discover more about diseases related to ELF3/ESE-1 Partial Recombinant Protein (H00001999-Q01).
 

Pathways for ELF3/ESE-1 Partial Recombinant Protein (H00001999-Q01)

View related products by pathway.

PTMs for ELF3/ESE-1 Partial Recombinant Protein (H00001999-Q01)

Learn more about PTMs related to ELF3/ESE-1 Partial Recombinant Protein (H00001999-Q01).
 

Research Areas for ELF3/ESE-1 Partial Recombinant Protein (H00001999-Q01)

Find related products by research area.

Blogs on ELF3/ESE-1

There are no specific blogs for ELF3/ESE-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ELF3/ESE-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ELF3
Entrez