ELF3/ESE-1 Antibody

Images

 
Western Blot: ELF3/ESE-1 Antibody [NBP1-87946] - Analysis in control (vector only transfected HEK293T lysate) and ELF3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: ELF3/ESE-1 Antibody [NBP1-87946] - Staining of human stomach shows moderate nuclear positivity in a subset of glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ELF3/ESE-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIRDILIHP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ELF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ELF3/ESE-1 Protein (NBP1-87946PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ELF3/ESE-1 Antibody

  • E74-like factor 3 (ets domain transcription factor, epithelial-specific )
  • E74-like factor 3
  • ELF3
  • Epithelial-restricted with serine box
  • epithelial-specific)
  • Epithelium-restricted Ets protein ESX
  • Epithelium-specific Ets transcription factor 1
  • EPR1
  • EPR-1
  • ERT
  • ESX
  • ets domain transcription factor, serine box (epithelial-specific)
  • ETS-related transcription factor Elf-3
  • JEN
  • serine box

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6146
Species: Hu
Applications: ICC
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-69295
Species: Hu
Applications: WB, ICC/IF, IHC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP

Publications for ELF3/ESE-1 Antibody (NBP1-87946) (0)

There are no publications for ELF3/ESE-1 Antibody (NBP1-87946).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELF3/ESE-1 Antibody (NBP1-87946) (0)

There are no reviews for ELF3/ESE-1 Antibody (NBP1-87946). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELF3/ESE-1 Antibody (NBP1-87946) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ELF3/ESE-1 Products

Bioinformatics Tool for ELF3/ESE-1 Antibody (NBP1-87946)

Discover related pathways, diseases and genes to ELF3/ESE-1 Antibody (NBP1-87946). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELF3/ESE-1 Antibody (NBP1-87946)

Discover more about diseases related to ELF3/ESE-1 Antibody (NBP1-87946).
 

Pathways for ELF3/ESE-1 Antibody (NBP1-87946)

View related products by pathway.

PTMs for ELF3/ESE-1 Antibody (NBP1-87946)

Learn more about PTMs related to ELF3/ESE-1 Antibody (NBP1-87946).
 

Research Areas for ELF3/ESE-1 Antibody (NBP1-87946)

Find related products by research area.

Blogs on ELF3/ESE-1

There are no specific blogs for ELF3/ESE-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ELF3/ESE-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ELF3
Entrez