EIF2G Antibody (1H3) - Azide and BSA Free

Sandwich ELISA: EIF2G Antibody (1H3) [H00001968-M03] - Detection limit for recombinant GST tagged EIF2S3 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1H3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

EIF2G Antibody (1H3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: EIF2S3 (NP_001406, 383 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: EIF2S3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: It has been used for ELISA and WB.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EIF2G Antibody (1H3) - Azide and BSA Free

• EIF2
• eIF-2gA
• eIF-2-gamma X
• EIF2gamma
• EIF2Geukaryotic translation initiation factor 2, subunit 3 (gamma, 52kD)
• eIF-2gX
• eukaryotic translation initiation factor 2 subunit 3
• Eukaryotic translation initiation factor 2 subunit gamma X
• eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa
• eukaryotic translation initiation factor 2G

Background

elF-2 gamma (also known as eukaryotic translation initiation factor eIF-2 gamma subunit and eukaryotic translation initiation factor 2 subunit 3) is a 52kD member of the GTP-binding elongation factor family, eIF2G subfamily. This cytoplasmic protein is ubiquitously expressed and has GTPase activity involved in the recruitment of methionyl-tRNA to the 40 S ribosomal subunit. Plays a role in translation initiation and elongation. Heterodimeric interaction with eIF-2 alpha and beta chains, acts as a cofactor for hepatitis C internal ribosome entry site-mediated translation. The Poly6068 antibody recognizes human eIF-2 gamma and has been shown to be useful for Western blotting.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EIF2S3
• Uniprot:
  • NP_001406(Human)