Recombinant Human EID1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human EID1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-187 of Human CRI1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
EID1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EID1 Protein

  • 21 kDa pRb-associated protein
  • C15orf3PTD014
  • CREBBP/EP300 inhibitor 1
  • CREBBP/EP300 inhibitory protein 1MGC138884
  • CRI1EP300-interacting inhibitor of differentiation 1
  • E1A-like inhibitor of differentiation 1
  • EID-1MGC138883
  • EP300 interacting inhibitor of differentiation 1
  • IRO45620
  • NB4 apoptosis related protein
  • Rb- and p300-binding protein EID-1
  • RBP21
  • retinoblastoma protein-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-46522
Species: Hu
Applications: WB, IHC
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94096
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46214
Species: Hu
Applications: WB, IHC
NBP2-38048
Species: Hu
Applications: IHC, IHC-P
PP-H7431-00
Species: Hu
Applications: WB
NBP2-32455
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP

Publications for EID1 Recombinant Protein (H00023741-P01) (0)

There are no publications for EID1 Recombinant Protein (H00023741-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EID1 Recombinant Protein (H00023741-P01) (0)

There are no reviews for EID1 Recombinant Protein (H00023741-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EID1 Recombinant Protein (H00023741-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EID1 Products

Bioinformatics Tool for EID1 Recombinant Protein (H00023741-P01)

Discover related pathways, diseases and genes to EID1 Recombinant Protein (H00023741-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EID1 Recombinant Protein (H00023741-P01)

Discover more about diseases related to EID1 Recombinant Protein (H00023741-P01).
 

Pathways for EID1 Recombinant Protein (H00023741-P01)

View related products by pathway.

PTMs for EID1 Recombinant Protein (H00023741-P01)

Learn more about PTMs related to EID1 Recombinant Protein (H00023741-P01).
 

Research Areas for EID1 Recombinant Protein (H00023741-P01)

Find related products by research area.

Blogs on EID1

There are no specific blogs for EID1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

EID1 Antibody
NBP2-47355

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EID1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EID1