EFCAB11 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: EFCAB11 Antibody [NBP2-56193] - Staining of human cell line MCF7 shows localization to cell junctions.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EFCAB11 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MFFSEARARSRTWEASPSEHRKWVEVFKACDEDHKGYLSREDFKTAVVMLFGYKPSKIEVDSVMSS
Specificity
Specificity of human EFCAB11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EFCAB11
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EFCAB11 Recombinant Protein Antigen (NBP2-56193PEP)

Reactivity Notes

Mouse 80%, Rat 80%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for EFCAB11 Antibody

  • C14orf143
  • chromosome 14 open reading frame 143
  • DKFZp547I1415
  • EF-hand calcium binding domain 11
  • EF-hand domain-containing protein C14orf143
  • FLJ51529

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16578
Species: Hu
Applications: WB, IHC, IHC-P
NBP3-04796
Species: Hu
Applications: WB, ICC/IF, IHC
AF3086
Species: Hu
Applications: WB, IHC
MAB2668
Species: Hu, Mu, Rt
Applications: WB
NBP1-58268
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-38866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30573
Species: Hu
Applications: IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-68974
Species: Hu
Applications: ICC/IF
NB100-81642
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-83195
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00123016-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-56193
Species: Hu
Applications: ICC/IF

Publications for EFCAB11 Antibody (NBP2-56193) (0)

There are no publications for EFCAB11 Antibody (NBP2-56193).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EFCAB11 Antibody (NBP2-56193) (0)

There are no reviews for EFCAB11 Antibody (NBP2-56193). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EFCAB11 Antibody (NBP2-56193) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EFCAB11 Products

Bioinformatics Tool for EFCAB11 Antibody (NBP2-56193)

Discover related pathways, diseases and genes to EFCAB11 Antibody (NBP2-56193). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EFCAB11 Antibody (NBP2-56193)

Discover more about diseases related to EFCAB11 Antibody (NBP2-56193).

Blogs on EFCAB11

There are no specific blogs for EFCAB11, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EFCAB11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EFCAB11