EEF1G Antibody

Western Blot: EEF1G Antibody [H00001937-D01P] - Analysis of EEF1G expression in mouse testis.

Western Blot: EEF1G Antibody [H00001937-D01P] - Analysis of EEF1G expression in PC-12.

Western Blot: EEF1G Antibody [H00001937-D01P] - Analysis of EEF1G expression in IMR-32.

Western Blot: EEF1G Antibody [H00001937-D01P] - Analysis of EEF1G expression in Raw 264.7.

Western Blot: EEF1G Antibody [H00001937-D01P] - Analysis of EEF1G expression in human placenta.

Western Blot: EEF1G Antibody [H00001937-D01P] - Analysis of EEF1G expression in transfected 293T cell line by EEF1G polyclonal antibody.Lane 1: EEF1G transfected lysate(50.10 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

EEF1G Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: EEF1G (NP_001395.1, 1 a.a. - 437 a.a.) full-length human protein. MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK
• Specificity: EEF1G - eukaryotic translation elongation factor 1 gamma,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EEF1G
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EEF1G Antibody

• eEF-1B gamma
• EF-1-gamma
• EF1Gelongation factor 1-gamma
• eukaryotic translation elongation factor 1 gamma
• GIG35
• pancreatic tumor-related protein
• PRO1608
• translation elongation factor eEF-1 gamma chain

Background

This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EEF1G
• Entrez:
  • 1937(Human)
• Uniprot:
  • NP_001395.1(Human)