EEF1G Antibody

Images

 
Western Blot: EEF1G Antibody [H00001937-D01P] - Analysis of EEF1G expression in mouse testis.
Western Blot: EEF1G Antibody [H00001937-D01P] - Analysis of EEF1G expression in PC-12.
Western Blot: EEF1G Antibody [H00001937-D01P] - Analysis of EEF1G expression in IMR-32.
Western Blot: EEF1G Antibody [H00001937-D01P] - Analysis of EEF1G expression in Raw 264.7.
Western Blot: EEF1G Antibody [H00001937-D01P] - Analysis of EEF1G expression in human placenta.
Western Blot: EEF1G Antibody [H00001937-D01P] - Analysis of EEF1G expression in transfected 293T cell line by EEF1G polyclonal antibody.Lane 1: EEF1G transfected lysate(50.10 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EEF1G Antibody Summary

Immunogen
EEF1G (NP_001395.1, 1 a.a. - 437 a.a.) full-length human protein. MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK
Specificity
EEF1G - eukaryotic translation elongation factor 1 gamma,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EEF1G
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EEF1G Antibody

  • eEF-1B gamma
  • EF-1-gamma
  • EF1Gelongation factor 1-gamma
  • eukaryotic translation elongation factor 1 gamma
  • GIG35
  • pancreatic tumor-related protein
  • PRO1608
  • translation elongation factor eEF-1 gamma chain

Background

This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-20393
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81556
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83420
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
H00094239-M08
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB4648
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-16094
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF8537
Species: Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-31317
Species: Hu
Applications: WB, ICC/IF
NBP2-45910
Species: Hu
Applications: WB, IHC
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000259-D01P
Species: Hu, Mu, Rt
Applications: WB

Publications for EEF1G Antibody (H00001937-D01P) (0)

There are no publications for EEF1G Antibody (H00001937-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EEF1G Antibody (H00001937-D01P) (0)

There are no reviews for EEF1G Antibody (H00001937-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EEF1G Antibody (H00001937-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EEF1G Products

Bioinformatics Tool for EEF1G Antibody (H00001937-D01P)

Discover related pathways, diseases and genes to EEF1G Antibody (H00001937-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EEF1G Antibody (H00001937-D01P)

Discover more about diseases related to EEF1G Antibody (H00001937-D01P).
 

Pathways for EEF1G Antibody (H00001937-D01P)

View related products by pathway.

Research Areas for EEF1G Antibody (H00001937-D01P)

Find related products by research area.

Blogs on EEF1G

There are no specific blogs for EEF1G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EEF1G Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EEF1G
Entrez
Uniprot