EEF1G Antibody (S1)

Images

 
Immunocytochemistry/ Immunofluorescence: EEF1G Antibody (S1) [H00001937-M03] - Analysis of monoclonal antibody to EEF1G on HeLa cell. Antibody concentration 10 ug/ml
Immunoprecipitation: EEF1G Antibody (S1) [H00001937-M03] - Analysis of EEF1G transfected lysate using anti-EEF1G monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with EEF1G rabbit polyclonal antibody.
Sandwich ELISA: EEF1G Antibody (S1) [H00001937-M03] - Detection limit for recombinant GST tagged EEF1G is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IP, S-ELISA
Clone
S1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EEF1G Antibody (S1) Summary

Immunogen
EEF1G (AAH15813.1, 1 a.a. ~ 437 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYHVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHDKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK
Specificity
EEF1G - eukaryotic translation elongation factor 1 gamma (S1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EEF1G
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EEF1G Antibody (S1)

  • eEF-1B gamma
  • EF-1-gamma
  • EF1Gelongation factor 1-gamma
  • eukaryotic translation elongation factor 1 gamma
  • GIG35
  • pancreatic tumor-related protein
  • PRO1608
  • translation elongation factor eEF-1 gamma chain

Background

This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75478
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20393
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31310
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD, KO
NBP1-81556
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-80461
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-94502
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83420
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP3-04426
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-75686
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16094
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KO
AF8537
Species: Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-31317
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45910
Species: Hu
Applications: WB, IHC
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-76910
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for EEF1G Antibody (H00001937-M03) (0)

There are no publications for EEF1G Antibody (H00001937-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EEF1G Antibody (H00001937-M03) (0)

There are no reviews for EEF1G Antibody (H00001937-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EEF1G Antibody (H00001937-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EEF1G Products

Bioinformatics Tool for EEF1G Antibody (H00001937-M03)

Discover related pathways, diseases and genes to EEF1G Antibody (H00001937-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EEF1G Antibody (H00001937-M03)

Discover more about diseases related to EEF1G Antibody (H00001937-M03).
 

Pathways for EEF1G Antibody (H00001937-M03)

View related products by pathway.

Research Areas for EEF1G Antibody (H00001937-M03)

Find related products by research area.

Blogs on EEF1G

There are no specific blogs for EEF1G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EEF1G Antibody (S1) and receive a gift card or discount.

Bioinformatics

Gene Symbol EEF1G
Entrez
Uniprot