EEF1D Antibody (4B12) - Azide and BSA Free

Western Blot: EEF1D Antibody (4B12) [H00001936-M04] - Analysis of EEF1D expression in human pancreas.

Immunocytochemistry/Immunofluorescence: EEF1D Antibody (4B12) [H00001936-M04] - Analysis of monoclonal antibody to EEF1D on HeLa cell. Antibody concentration 10 ug/ml

Western Blot: EEF1D Antibody (4B12) [H00001936-M04] - EEF1D monoclonal antibody (M04), clone 4B12. Western Blot analysis of EEF1D expression in HepG2 ( Cat # L019V1 ).

ELISA: EEF1D Antibody (4B12) [H00001936-M04] - Detection limit for recombinant GST tagged EEF1D is approximately 1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 4B12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

EEF1D Antibody (4B12) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: EEF1D (NP_115754, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRSGKASCTLETVWEDKHKYEEAERRFYEHEATQAAASAQQLPAEGPAMNGPGQDDPEDADEAEAPDGGSRRDPRKSQDSRKPLQKKRKRS
• Specificity: EEF1D - eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (4B12)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: EEF1D
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EEF1D Antibody (4B12) - Azide and BSA Free

• Antigen NY-CO-4
• EF-1D
• EF-1-delta
• EF1DFP1047
• elongation factor 1-delta
• eukaryotic translation elongation factor 1 delta (guanine nucleotide exchangeprotein)
• FLJ20897
• guanine nucleotide exchange protein

Background

This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit functions as guanine nucleotide exchange factor. It is reported that this subunit interacts with HIV-1 Tat, and thus it represses the translation of host-cell, but not HIV-1, mRNAs. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EEF1D
• Entrez:
  • 1936(Human)
• Uniprot:
  • NP_115754(Human)