EDR1/PHC1 Antibody [DyLight 680]

Product Discontinued

EDR1/PHC1 Antibody [DyLight 680] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 750-940 of human EDR1/PHC1 (NP_004417.2).
  
  Sequence:
  FPVGCSQLLKESEKPLQTGLPTGLTENQSGGPLGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEFQEANYARVRRRGPRRSSSDIARAKIQGKCHRGQEDSSRGSDNSSYDEALSPTSPGPLSVRAGHGERDLGNPNTAPPTPELHGINPVFLSSNPSRW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PHC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for EDR1/PHC1 Antibody [DyLight 680]

• early development regulator 1 (homolog of polyhomeotic 1)
• Early development regulatory protein 1
• EDR1
• HPH1
• PH1
• polyhomeotic homolog 1 (Drosophila)
• polyhomeotic-like 1 (Drosophila)
• polyhomeotic-like 1
• polyhomeotic-like protein 1
• RAE28

Background

EDR1 / PHC1 is a homolog of the Drosophila polyhomeotic gene, which is a member of the Polycomb group of genes. The gene product is a component of a multimeric protein complex that contains EDR2 and the vertebrate Polycomb protein BMH1. The gene product, the EDR2 protein, and the Drosophila polyhomeotic protein share 2 highly conserved domains, named homology domains I and II. These domains are involved in protein-protein interactions and may mediate heterodimerization of the protein encoded by this gene and the EDR2 protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PHC1