Recombinant Human EDEM3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human EDEM3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-122 of Human C1orf22 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGGFKYGDEQPRSDWRSYRRNLEHAVLELTLFKTVPSKMEIHSSPFKCSTAPPCNTSGQGKITEHSCEPDFCCLWIDKKQNSFSSGVGNRSLDSLLIKGSSPFLVLGVRGSFGKMHPSIVAF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
EDEM3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EDEM3 Protein

  • C1orf22
  • chromosome 1 open reading frame 22
  • ER degradation enhancer, mannosidase alpha-like 3
  • ER degradation-enhancing alpha-mannosidase-like 3
  • ER degradation-enhancing -mannosidase-like protein 3

Background

Quality control in the endoplasmic reticulum (ER) ensures that only properly folded proteins are retained in the cell through recognition and degradation of misfolded or unassembled proteins. EDEM3 belongs to a group of proteins that accelerate degradation of misfolded glycoproteins in the ER (Hirao et al., 2006 [PubMed 16431915]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00055741-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-82802
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81623
Species: Hu
Applications: IHC, IHC-P
NB100-519
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-2526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, KO
NBP1-86802
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45402
Species: Hu
Applications: WB, Flow, IHC
AF1543
Species: Hu
Applications: WB, IHC
NBP1-81884
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31293
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-46278
Species: Hu
Applications: WB, IHC, IF
NBP1-92252
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EDEM3 Recombinant Protein (H00080267-P01) (0)

There are no publications for EDEM3 Recombinant Protein (H00080267-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EDEM3 Recombinant Protein (H00080267-P01) (0)

There are no reviews for EDEM3 Recombinant Protein (H00080267-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EDEM3 Recombinant Protein (H00080267-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EDEM3 Products

Bioinformatics Tool for EDEM3 Recombinant Protein (H00080267-P01)

Discover related pathways, diseases and genes to EDEM3 Recombinant Protein (H00080267-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EDEM3 Recombinant Protein (H00080267-P01)

Discover more about diseases related to EDEM3 Recombinant Protein (H00080267-P01).
 

Pathways for EDEM3 Recombinant Protein (H00080267-P01)

View related products by pathway.

PTMs for EDEM3 Recombinant Protein (H00080267-P01)

Learn more about PTMs related to EDEM3 Recombinant Protein (H00080267-P01).
 

Research Areas for EDEM3 Recombinant Protein (H00080267-P01)

Find related products by research area.

Blogs on EDEM3

There are no specific blogs for EDEM3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

EDEM3 Antibody
NBP1-88342

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EDEM3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EDEM3