Ebf4 Antibody

Images

 
Western Blot: Ebf4 Antibody [NBP2-84016] - WB Suggested Anti-EBF4 Antibody Titration: 2.5ug/ml. ELISA Titer: 1:312500. Positive Control: SP2/0 cell lysate

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ebf4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human Ebf4. Peptide sequence: YDRQGQPVEVERTAFIDFVEKDREPGTEKTNNGIHYRLRLVYNNGLRTEQ The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
EBF4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for Ebf4 Antibody

  • early B-cell factor 4
  • EBF-4
  • olf-1/EBF-like 4
  • transcription factor COE4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5165
Species: Hu, Mu
Applications: WB
AF6116
Species: Hu
Applications: ICC, WB
202-IL
Species: Hu
Applications: BA
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-80090
Species: Hu
Applications: WB
NB100-56563
Species: Hu, Mu, Rt
Applications: DB, Flow-CS, Flow-IC, Flow, IHC, IHC-P, WB
NBP2-41305
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00253738-M05
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-84295
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-37424
Species: Hu
Applications: ELISA, WB
NBP2-87563
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-84016
Species: Mu
Applications: WB

Publications for Ebf4 Antibody (NBP2-84016) (0)

There are no publications for Ebf4 Antibody (NBP2-84016).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ebf4 Antibody (NBP2-84016) (0)

There are no reviews for Ebf4 Antibody (NBP2-84016). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ebf4 Antibody (NBP2-84016) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ebf4 Products

Bioinformatics Tool for Ebf4 Antibody (NBP2-84016)

Discover related pathways, diseases and genes to Ebf4 Antibody (NBP2-84016). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for Ebf4 Antibody (NBP2-84016)

Find related products by research area.

Blogs on Ebf4

There are no specific blogs for Ebf4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ebf4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EBF4