Recombinant Human EAF2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human EAF2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-260 of Human EAF2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNLVKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRDNSGLLMNTLRNDLQLSESGSDSDD

Protein/Peptide Type
Recombinant Protein
Gene
EAF2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EAF2 Protein

  • BM040
  • ELL associated factor 2
  • testosterone regulated apoptosis inducer and tumor suppressor
  • Testosterone-regulated apoptosis inducer and tumor suppressor protein
  • TRAITSELL-associated factor 2
  • U19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84063
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00085403-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-45545
Species: Hu
Applications: WB, IHC
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP1-89106
Species: Hu
Applications: IHC, IHC-P
NBP2-55603
Species: Hu
Applications: WB, ICC/IF
AF475
Species: Mu
Applications: WB, IHC
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-28728
Species: Hu
Applications: IP (-), WB, IHC
NB100-485
Species: Hu
Applications: WB, IP
NBL1-11569
Species: Hu

Publications for EAF2 Recombinant Protein (H00055840-P01) (0)

There are no publications for EAF2 Recombinant Protein (H00055840-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EAF2 Recombinant Protein (H00055840-P01) (0)

There are no reviews for EAF2 Recombinant Protein (H00055840-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EAF2 Recombinant Protein (H00055840-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EAF2 Products

Bioinformatics Tool for EAF2 Recombinant Protein (H00055840-P01)

Discover related pathways, diseases and genes to EAF2 Recombinant Protein (H00055840-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EAF2 Recombinant Protein (H00055840-P01)

Discover more about diseases related to EAF2 Recombinant Protein (H00055840-P01).
 

Pathways for EAF2 Recombinant Protein (H00055840-P01)

View related products by pathway.

PTMs for EAF2 Recombinant Protein (H00055840-P01)

Learn more about PTMs related to EAF2 Recombinant Protein (H00055840-P01).

Blogs on EAF2

There are no specific blogs for EAF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

EAF2 Antibody
NBP1-88578

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EAF2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EAF2