E2F8 Antibody [mFluor Violet 610 SE] Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 788-867 of human E2F8 (NP_078956.2).
Sequence: PVPGQSQPNGQSVAVTGAQQPVPVTPKGSQLVAESFFRTPGGPTKPTSSSCMDFEGANKTSLGTLFVPQRKLEVSTEDVH |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
E2F8 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Affinity purified |
Notes
mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
Alternate Names for E2F8 Antibody [mFluor Violet 610 SE]
Background
E2F8 is a gene that codes for a protein that is 867 amino acids long, weighs approximately 94 kDa, that is an atypical E2F transcription factor that helps facilitate with various processes including angiogenesis and the polyploidization of specialized cells, especially those in the placenta and liver. Current studies are being done on diseases and disorders related to this gene including hepatocellular carcinoma. E2F8 has also been shown to have interactions with E2F7, EWSR1, and LZTR1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, WB
Publications for E2F8 Antibody (NBP3-35168MFV610) (0)
There are no publications for E2F8 Antibody (NBP3-35168MFV610).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for E2F8 Antibody (NBP3-35168MFV610) (0)
There are no reviews for E2F8 Antibody (NBP3-35168MFV610).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for E2F8 Antibody (NBP3-35168MFV610) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional E2F8 Products
Research Areas for E2F8 Antibody (NBP3-35168MFV610)
Find related products by research area.
|
Blogs on E2F8