E2F-4 Antibody

Images

 
Immunohistochemistry: E2F-4 Antibody [NBP3-10895] - Immunohistochemical analysis of human intestine.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

E2F-4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human E2F-4 (NP_001941). Peptide sequence SSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCDLFDVPVLNL
Clonality
Polyclonal
Host
Rabbit
Gene
E2F4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
Theoretical MW
44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for E2F-4 Antibody

  • E2F transcription factor 4, p107/p130-binding
  • E2F4
  • E2F-4
  • E2F-4p107/p130-binding protein
  • transcription factor E2F4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67899
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-82455
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38206
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP1-58200
Species: Hu, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-33735
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-26616
Species: Hu
Applications: IP, WB
NB100-56598
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
NBP2-99198
Species: Hu
Applications: IHC, IHC-P, IP (-), IP, WB
NBP1-80295
Species: Hu
Applications: WB
AF5119
Species: Hu
Applications: WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-31308
Species: Bv, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-92787
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00005729-B01P
Species: Hu
Applications: Flow, ICC/IF, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-46085
Species: Hu
Applications: IHC, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB

Publications for E2F-4 Antibody (NBP3-10895) (0)

There are no publications for E2F-4 Antibody (NBP3-10895).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for E2F-4 Antibody (NBP3-10895) (0)

There are no reviews for E2F-4 Antibody (NBP3-10895). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for E2F-4 Antibody (NBP3-10895) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional E2F-4 Products

Bioinformatics Tool for E2F-4 Antibody (NBP3-10895)

Discover related pathways, diseases and genes to E2F-4 Antibody (NBP3-10895). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for E2F-4 Antibody (NBP3-10895)

Discover more about diseases related to E2F-4 Antibody (NBP3-10895).
 

Pathways for E2F-4 Antibody (NBP3-10895)

View related products by pathway.

PTMs for E2F-4 Antibody (NBP3-10895)

Learn more about PTMs related to E2F-4 Antibody (NBP3-10895).
 

Research Areas for E2F-4 Antibody (NBP3-10895)

Find related products by research area.

Blogs on E2F-4

There are no specific blogs for E2F-4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our E2F-4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol E2F4